Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00051X
         (336 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   3.1  
AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          23   4.1  
AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.    22   7.1  
AY324307-1|AAQ89692.1|  154|Anopheles gambiae insulin-like pepti...    21   9.4  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    21   9.4  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -1

Query: 177  STGATNGVNRPP 142
            STG++N  NRPP
Sbjct: 1627 STGSSNSCNRPP 1638


>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = +1

Query: 124 CCNIWHWGSVDS 159
           CC +W W  ++S
Sbjct: 88  CCRLWRWPDLNS 99


>AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.
          Length = 163

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = -2

Query: 236 SMLVQQRLCFLPLFPLS*NRAREPLMESTDPQCHILQHR 120
           SMLV   +   P  PLS ++++ P  ++     H L H+
Sbjct: 38  SMLVTGSMPPSPYAPLSMSKSQTPPQDTVGTAQHQLHHQ 76


>AY324307-1|AAQ89692.1|  154|Anopheles gambiae insulin-like peptide
           1 precursor protein.
          Length = 154

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -2

Query: 125 HRRPRLPLMQLEAPCSFNFCSLRAIRRY 42
           HRR R    Q+ A C +  C+L  ++ Y
Sbjct: 127 HRRVR---RQVVAECCYQSCTLDTLKSY 151


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +1

Query: 259 HCVTVDCCC 285
           H  T DCCC
Sbjct: 125 HADTTDCCC 133


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 324,459
Number of Sequences: 2352
Number of extensions: 5726
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 56
effective length of database: 432,267
effective search space used: 23774685
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)