BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00048 (410 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 147 4e-36 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 147 bits (356), Expect = 4e-36 Identities = 68/98 (69%), Positives = 80/98 (81%) Frame = +3 Query: 21 MTRKXRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVDSAAVRDINDASVYP 200 MT+K NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIV++AAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 201 MFQLPKLYAKLHYCVSCASTAKLSGTDRRKTEESVLLP 314 ++ LPKLY KLHYCVSCA +K+ +R K + + P Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVV-RNRSKEDRKIRTP 97 Score = 41.9 bits (94), Expect = 2e-04 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = +2 Query: 254 LHSKVVRNRSKKDRRIRTPP 313 +HSKVVRNRSK+DR+IRTPP Sbjct: 79 IHSKVVRNRSKEDRKIRTPP 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,189,598 Number of Sequences: 59808 Number of extensions: 202395 Number of successful extensions: 465 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -