BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00046 (836 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 39 0.004 SB_29436| Best HMM Match : PAN (HMM E-Value=0.021) 34 0.12 SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) 33 0.29 SB_50645| Best HMM Match : Syndecan (HMM E-Value=0.02) 33 0.29 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 33 0.29 SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) 32 0.50 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 32 0.66 SB_50834| Best HMM Match : GCR (HMM E-Value=2.5) 31 0.88 SB_28454| Best HMM Match : SDA1 (HMM E-Value=1.7) 31 0.88 SB_44228| Best HMM Match : LMP (HMM E-Value=0.11) 31 1.2 SB_51277| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_32608| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_28622| Best HMM Match : CcmD (HMM E-Value=0.55) 30 2.0 SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) 30 2.7 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 30 2.7 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_34153| Best HMM Match : DUF972 (HMM E-Value=0.17) 29 3.5 SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) 29 3.5 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 29 4.7 SB_37953| Best HMM Match : Myco_haema (HMM E-Value=4.1) 29 4.7 SB_9683| Best HMM Match : RCSD (HMM E-Value=2.8) 29 4.7 SB_1116| Best HMM Match : THAP (HMM E-Value=0.00013) 29 4.7 SB_29462| Best HMM Match : DUF753 (HMM E-Value=3.5) 29 6.2 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_5337| Best HMM Match : ResIII (HMM E-Value=2.4) 29 6.2 SB_35441| Best HMM Match : ResIII (HMM E-Value=0.078) 28 8.2 SB_26626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 28 8.2 SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) 28 8.2 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 28 8.2 SB_42323| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_37853| Best HMM Match : REJ (HMM E-Value=0.00025) 28 8.2 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) 28 8.2 >SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 344 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/76 (32%), Positives = 36/76 (47%) Frame = +2 Query: 494 QTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNV 673 Q R+I+ S + ++P PR SP + TK TK A PR SPK + KP + Sbjct: 257 QAGRKIKISKPQNHKQAPRPRQASPKTKGQASPKTKSTKPARPRQASPKAK--TSKPQDQ 314 Query: 674 PGYLRPTRTSQIKEET 721 + R S +K +T Sbjct: 315 DKQVARPRQSSLKTKT 330 >SB_29436| Best HMM Match : PAN (HMM E-Value=0.021) Length = 419 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 3/78 (3%) Frame = +2 Query: 515 ESPSRLST-ESPVPRSKSPIRHTVETVTTKITKSAA--PRGESPKQRPENDKPDNVPGYL 685 ESP ST E+P +S + T T T T+S P +S + PE + P Sbjct: 99 ESPETQSTTETPETQSTTESPETQSTTQTPETQSTTETPETQSTTETPETQSTTDTPETQ 158 Query: 686 RPTRTSQIKEETIIHDTE 739 PT+T + + T +T+ Sbjct: 159 SPTQTPETQSTTTTPETQ 176 >SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) Length = 968 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = +2 Query: 125 PTKHPEEIRHVTPDRSKETVKLHPKVKDFKTPTQKAADKTPIKIQH*GAANRQKS*SIIR 304 P H E TP K T ++HP + T T + TP ++ A R+ + Sbjct: 843 PRLHAEYTHAYTPSTPKPTHRVHPSLHAGYTHTYTPSTPTPTHAEYTHAYTRRVHKRLHA 902 Query: 305 EYCIYYTKS 331 EY + YT S Sbjct: 903 EYTLAYTPS 911 >SB_50645| Best HMM Match : Syndecan (HMM E-Value=0.02) Length = 226 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 384 TPKPETLRHKNDHPNVTEDEVEMNTT--VIKTERSIESIKPQEEYAKVQVAYPQNHQSRD 557 T KP+ K P V +EVE+ T V TE+ E +KP E V P+N + D Sbjct: 97 TRKPKPKDRKTKEPKVETEEVEITTAEPVKPTEKPTEFVKPTTE-DDVMETDPENPKEGD 155 Query: 558 LNHR 569 + R Sbjct: 156 MQAR 159 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 33.1 bits (72), Expect = 0.29 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 4/97 (4%) Frame = +2 Query: 485 RINQTSRRIRESPSRLSTESPVPR-SKSPI--RHTVETVTTKITKSAA-PRGESPKQRPE 652 R SR S S+ + SP P+ +++ + RHT ++SA PRG P++RP Sbjct: 448 RSRSYSRSRSRSFSKSISGSPTPKYTRTTVKPRHTDREPRRDFSRSAERPRGRPPRERPR 507 Query: 653 NDKPDNVPGYLRPTRTSQIKEETIIHDTEVSSRRGVE 763 +P + RP R Q ++ + D E R +E Sbjct: 508 EIRPSR-ERFGRPERDRQERDRP-VRDRETYRDRELE 542 >SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = +2 Query: 533 STESPVPRSKSPIRHTVETVTTKITKSAA--PRGESPKQRPENDKPDNVPGYLRPTRTSQ 706 +TE+P +S + T T TT T+S P +SP Q PE P T T + Sbjct: 345 TTETPETQSTTTTPETQSTTTTPETQSTTETPETQSPTQTPETQLTTETPETQSTTTTPE 404 Query: 707 IKEETIIHDTE 739 + T +T+ Sbjct: 405 TQSTTGTPETQ 415 >SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 32.3 bits (70), Expect = 0.50 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = +2 Query: 458 HSN*NRAFNRINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKI-TKSAAPRGES 634 HS+ N F N R+ RE P S +S V S S VET ++ KS P+ S Sbjct: 841 HSSQNGDFETSNGKLRKKREKPKHNSPDSEVETSDSSSDDEVETSDRQLRRKSEKPKYNS 900 Query: 635 PKQRPE 652 P E Sbjct: 901 PDSEGE 906 >SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 32.3 bits (70), Expect = 0.50 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +2 Query: 515 ESPS-RLSTESPVPR--SKSPIRHTVETVTTKITKSAA--PRGESPKQRPENDKPDNVP 676 E+P+ R S+E P R S++P + ET T K+ A P E+P RP ++ P P Sbjct: 511 EAPTTRPSSEKPTTRPFSETPTSTSSETPTKTFNKTPATRPSSETPTTRPSSETPTTKP 569 >SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) Length = 998 Score = 32.3 bits (70), Expect = 0.50 Identities = 24/67 (35%), Positives = 32/67 (47%) Frame = +2 Query: 434 RGRS*DEHHSN*NRAFNRINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKITKS 613 R RS S R+ + I Q S S S + SP R +S HT++T+TT T S Sbjct: 314 RQRSHSHIPSTQGRSRSAIKQESFDDERSSSDETKPSPATRRRS---HTLDTITTSPTPS 370 Query: 614 AAPRGES 634 P GE+ Sbjct: 371 LTPIGEA 377 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 31.9 bits (69), Expect = 0.66 Identities = 26/84 (30%), Positives = 33/84 (39%) Frame = +2 Query: 569 IRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETIIHDTEVSS 748 +R+ TT TK AP+GE P P VPG P S I + E+ Sbjct: 982 VRYPDGRETTVSTKHLAPKGEVPTMYPLPQVKPTVPGEHHPATGSSPPSSEI--EVEIGV 1039 Query: 749 RRGVEFGVELRRRALNVLQRAVRG 820 V G E R + L R+V G Sbjct: 1040 GEEVPQGTEARYKHFQ-LSRSVYG 1062 >SB_50834| Best HMM Match : GCR (HMM E-Value=2.5) Length = 909 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/63 (34%), Positives = 32/63 (50%) Frame = +2 Query: 632 SPKQRPENDKPDNVPGYLRPTRTSQIKEETIIHDTEVSSRRGVEFGVELRRRALNVLQRA 811 SP+ RP DKP P RP+ Q K+ T++ +S + + V+LR R L LQ + Sbjct: 291 SPEFRPL-DKPKGQPQGSRPSNEVQSKDSTVM----ISKTKLRKLDVKLRNRLLEYLQES 345 Query: 812 VRG 820 G Sbjct: 346 PGG 348 >SB_28454| Best HMM Match : SDA1 (HMM E-Value=1.7) Length = 383 Score = 31.5 bits (68), Expect = 0.88 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 10/98 (10%) Frame = +2 Query: 485 RINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKI----------TKSAAPRGES 634 R+ S IRE LS P + + IR+T TK TK+ RG+S Sbjct: 202 RVKDASNMIREM---LSEAVPKADTLTKIRYTPPKPKTKAITKVANDRYGTKTTNKRGKS 258 Query: 635 PKQRPENDKPDNVPGYLRPTRTSQIKEETIIHDTEVSS 748 P+Q N KP +PG+ + TR + +I + ++S Sbjct: 259 PRQANRNVKP--MPGHAQATRGIEAHRAGVIGEHPLTS 294 >SB_44228| Best HMM Match : LMP (HMM E-Value=0.11) Length = 276 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/77 (22%), Positives = 35/77 (45%) Frame = +3 Query: 426 NVTEDEVEMNTTVIKTERSIESIKPQEEYAKVQVAYPQNHQSRDLNHRSDILLKRSQRKL 605 N ED+V + + + E++IES + + +++ HQ L+ + + L + + Sbjct: 176 NANEDKVTLKEQLKQMEQAIESQRQRHSDEIQRISAEHEHQCAKLSQKIESLSSEQEEAI 235 Query: 606 QNLLHQEGNLRSSGLKM 656 Q+L Q +KM Sbjct: 236 QDLEKQLKKANKESVKM 252 >SB_51277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/59 (32%), Positives = 22/59 (37%) Frame = +2 Query: 551 PRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETII 727 PR I H++E T + R P Q PDN PG L PT E I Sbjct: 95 PRRLFMIDHSLEGWITNAVYTGISRVRHPDQIVRVIPPDNAPGTLAPTELQATPSEEFI 153 >SB_32608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 909 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/86 (24%), Positives = 31/86 (36%), Gaps = 1/86 (1%) Frame = +2 Query: 491 NQTSRRIRESPSRLSTESPVPRSKSPIRHTVETV-TTKITKSAAPRGESPKQRPENDKPD 667 NQT R+ PSR ++ S S+ P+ + E +T + E Sbjct: 587 NQTDSRLDTGPSRTASSSKSQCSRDPLHSSSEDANSTGMLVGITQENERNSSEHSTRNSS 646 Query: 668 NVPGYLRPTRTSQIKEETIIHDTEVS 745 N GY RT T+ H + S Sbjct: 647 NCEGYQSIRRTKSSATATLSHSFDSS 672 >SB_28622| Best HMM Match : CcmD (HMM E-Value=0.55) Length = 1087 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 5/67 (7%) Frame = +2 Query: 518 SPSRLSTESPVPRSKSPIRHTVETVTTKIT-----KSAAPRGESPKQRPENDKPDNVPGY 682 SP + +T+ + +S RH + ++TT+ T S P SP P P P Sbjct: 230 SPQKTATKPSTFQPQSSTRHPLTSITTRTTPIKPSPSTTPIKPSPSTTPIKPSPSTTPIK 289 Query: 683 LRPTRTS 703 P+ TS Sbjct: 290 PSPSTTS 296 >SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) Length = 1020 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = +2 Query: 518 SPSRLSTESPVPRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTR 697 SP + +T+ + +S RH + ++TT+ T P SP P P P P+ Sbjct: 306 SPQKTATKPSTFQPQSSTRHPLTSITTRTT----PIKPSPSTTPIKPSPSTTPIKPSPST 361 Query: 698 TS 703 TS Sbjct: 362 TS 363 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 29.9 bits (64), Expect = 2.7 Identities = 35/162 (21%), Positives = 64/162 (39%), Gaps = 5/162 (3%) Frame = +3 Query: 201 LKISKHQPKKRLIKLRLRYNIKEQRTVK-KAKALFENIASXXXXXXXXXXXXXXXXXGVN 377 L++ K + IK+RL+ NIK R K K KA E I+S + Sbjct: 273 LELDKAKKNFEKIKIRLKNNIKSTREEKEKMKAEIEKISS--EKHEICTKLRQEFEEALK 330 Query: 378 QKTPKPETLRHKNDHPNVTEDEVEMNTTV----IKTERSIESIKPQEEYAKVQVAYPQNH 545 K +LR + + +D + N E I+++ + A Y Sbjct: 331 DKDDVLSSLREEMECLRAEKDSLVSNLDTRAEGSTIEEKIQAMDTERMVAASPGEYLNEA 390 Query: 546 QSRDLNHRSDILLKRSQRKLQNLLHQEGNLRSSGLKMTSLIT 671 S+D R + L+ QR+ + +L ++ +R + S+++ Sbjct: 391 HSQDEIERLKLELEVVQREKEQILEEKDRIREIVKEENSMVS 432 >SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 545 PVPRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPG 679 P+P KSP + + + + TK PR ES +Q +N KP G Sbjct: 141 PIPSMKSPSQTAIRSPSQ--TKPP-PRSESKRQEQQNSKPTETRG 182 >SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +2 Query: 470 NRAFNRINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKITKSAAPRGESPKQ 643 N+ + +NQT +++SP R S E+ P + T K TK ++ + S K+ Sbjct: 186 NQKKSPLNQTIDHLKKSPKRSSHEAKSPTKSTSSHDTKSKSPCKATKESSSKVMSSKE 243 >SB_34153| Best HMM Match : DUF972 (HMM E-Value=0.17) Length = 473 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +3 Query: 501 QEEYAKVQVAYPQNHQSRDLNHRSDILLKRSQRKLQNLLHQEGNLRSS 644 +EE+A++QV + ++ R LNH L R +QE +RSS Sbjct: 7 EEEFARIQVDFQKHVIPRFLNHSFSCLRVECHRANNRSANQELRIRSS 54 >SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) Length = 743 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/59 (32%), Positives = 23/59 (38%) Frame = +2 Query: 551 PRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETII 727 PR I H++E T + R Q PDN PG L PTR E +I Sbjct: 389 PRRLFIIDHSLEGWITNAVYTGISRVRHADQIVRVISPDNTPGALVPTRLQATPSEELI 447 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/78 (21%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = +2 Query: 584 ETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETII--HDTEVSSRRG 757 E +++ ++ + +P+G K+RP + P ++PT + I E+ +RR Sbjct: 30 EALSSSVSPTKSPKGTKGKKRPSSSSVFKSPKRIKPTENQSVSSNDNISQEHVEIITRRN 89 Query: 758 VE----FGVELRRRALNV 799 E RR+L + Sbjct: 90 TRSKSVIVTEATRRSLRI 107 >SB_37953| Best HMM Match : Myco_haema (HMM E-Value=4.1) Length = 838 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/91 (23%), Positives = 35/91 (38%) Frame = +2 Query: 458 HSN*NRAFNRINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKITKSAAPRGESP 637 + N N N +N + I S T+ + P T +T T+K+T +A S Sbjct: 743 NGNPNDLENLLNTDNETIGHSTIEQQTQFTDKPTDKP---TEQTPTSKVTSAAMETKSSG 799 Query: 638 KQRPENDKPDNVPGYLRPTRTSQIKEETIIH 730 KP+++ L PT + +H Sbjct: 800 AHDDSGIKPEDIINKLSPTEGQSASQAPFVH 830 >SB_9683| Best HMM Match : RCSD (HMM E-Value=2.8) Length = 232 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 3/92 (3%) Frame = +2 Query: 476 AFNRINQTSRRIRESPSRLS---TESPVPRSKSPIRHTVETVTTKITKSAAPRGESPKQR 646 +F ++T + S SR T +P P ++SP H+ E++ T + P +S Sbjct: 77 SFTSKSETRESVTHSMSRFPAYRTVNPTPVTQSPTSHSHESIKTSSSTKNIPASKSQTLS 136 Query: 647 PENDKPDNVPGYLRPTRTSQIKEETIIHDTEV 742 + V + PT T ++ T+V Sbjct: 137 TR----ETVASEIMPTSTRTTTSHVVMPTTQV 164 >SB_1116| Best HMM Match : THAP (HMM E-Value=0.00013) Length = 331 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 131 KHPEEIRHVTPDRSKETVKLHPKVKDFKTPTQKAADKTPIK 253 K P+E +P ++ T PK ++ KT T KA D P+K Sbjct: 105 KRPDE----SPKDARTTHDTKPKTRNQKTATSKATDPRPVK 141 >SB_29462| Best HMM Match : DUF753 (HMM E-Value=3.5) Length = 199 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +3 Query: 375 NQKTPKPETLRHKNDHPNVTEDEVEMNTTVIKTERSIESIKPQEEYAKVQVAYPQNHQSR 554 NQ T ETL +V E V++NT+ + RS+ S K ++ K+ ++ Q H+ Sbjct: 17 NQHTKLQETLPKIAKKDDVDETRVDVNTS---SRRSVSSKKLSKDVPKLSTSF-QEHECA 72 Query: 555 D 557 D Sbjct: 73 D 73 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.7 bits (61), Expect = 6.2 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +2 Query: 440 RS*DEHHSN*NRAFNRINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKITKSAA 619 RS D+ S ++ R R +SP + +S RS+SP R E +TKS Sbjct: 250 RSRDKSRSR-EKSRERGGSRGRSAEKSPEKQRDKSDDRRSRSPERKIKE---DSVTKSDE 305 Query: 620 PRGESPKQRPENDK 661 G S ++R + +K Sbjct: 306 DEGRSSERREKEEK 319 >SB_5337| Best HMM Match : ResIII (HMM E-Value=2.4) Length = 392 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/59 (30%), Positives = 23/59 (38%) Frame = +2 Query: 551 PRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETII 727 PR I H++E T + R Q PDN PG L PT + E +I Sbjct: 309 PRRLFIIDHSLEGWITNAVYNGISRVRHADQIVRVIPPDNAPGALAPTELQAMPSEELI 367 >SB_35441| Best HMM Match : ResIII (HMM E-Value=0.078) Length = 767 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/59 (30%), Positives = 23/59 (38%) Frame = +2 Query: 551 PRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETII 727 PR I H++E + T + R Q PDN PG L PT E +I Sbjct: 676 PRRLFIIDHSLEGLITNAVYTGTSRVRHADQIVRVIPPDNTPGALVPTGLQATPSEELI 734 >SB_26626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/59 (30%), Positives = 23/59 (38%) Frame = +2 Query: 551 PRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIKEETII 727 PR I H++E T + R Q PDN PG L PT + E +I Sbjct: 710 PRRLFIIDHSLEGWITNAVYTGISRVRHADQIVRVIPPDNAPGALVPTELQTTRSEELI 768 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 28.3 bits (60), Expect = 8.2 Identities = 30/127 (23%), Positives = 50/127 (39%), Gaps = 3/127 (2%) Frame = +2 Query: 437 GRS*DEHHSN*NRAFNRINQTSRRIRESPSRLSTESPVPRSKSPIRHTVETVTTKITKSA 616 G+S D +R+ R R R PSR +S + R +SP+R+ + Sbjct: 404 GKSEDNSSLRRSRSRERNMARDRDDRRPPSRSRRDSSLRRQRSPLRNR--------SPRW 455 Query: 617 APRGESPKQRPENDKPDNVPGYLRPTRTSQIKEET---IIHDTEVSSRRGVEFGVELRRR 787 R SP+ R D G +T + + E+ +++ S V+ +E RRR Sbjct: 456 RGRSPSPRSRRRRRSSDRYKGSFSEGQTGKSESESDNELVNFELDSDEEDVDKIIERRRR 515 Query: 788 ALNVLQR 808 + R Sbjct: 516 QRQAIVR 522 >SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) Length = 353 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 466 LKPSVQSNQSNLKKNTRKSKSLIHRITSPE 555 L PS+ Q+ + T K +HR+TSPE Sbjct: 160 LVPSLPERQTGQRNRTNKLLMNLHRVTSPE 189 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = +2 Query: 533 STESPVPRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIK 712 S +P RS+ ++ T ++ + + RG R + K RPTR S K Sbjct: 646 SCRTPRDRSRENGKNHQRTKSSGKDSTCSTRGSRDTSRDTSCKDTTGSAGTRPTRQSPRK 705 Query: 713 EETIIHDTEVSSRRG 757 ++T SSR+G Sbjct: 706 SAAKNNETPKSSRKG 720 >SB_42323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 280 TVRCSLMLYLNRSFISRFLGW 218 T RC+++L+L R F+SR L W Sbjct: 173 TARCAVILWLYRLFLSRSLYW 193 >SB_37853| Best HMM Match : REJ (HMM E-Value=0.00025) Length = 2182 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 387 PKPETLRHKNDHPNVTEDEVEMNTTVIKTERSIESIKPQEEYAKVQVAYP 536 P P T ++ EV +TT + E+++P E+ A+VQV +P Sbjct: 1914 PTPTTEAATTTGKVLSSTEVMTDTTPTIVGSTTETVRPPEKPARVQVKFP 1963 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = +2 Query: 533 STESPVPRSKSPIRHTVETVTTKITKSAAPRGESPKQRPENDKPDNVPGYLRPTRTSQIK 712 S +P RS+ ++ T ++ + + RG R + K RPTR S K Sbjct: 1313 SCRTPRDRSRENGKNHQRTKSSGKDSTCSTRGSRDTSRDTSCKDTTGSAGTRPTRQSPRK 1372 Query: 713 EETIIHDTEVSSRRG 757 ++T SSR+G Sbjct: 1373 SAAKNNETPKSSRKG 1387 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -2 Query: 823 RSSHCSLQHVQRSSTKLHAKLHATTTAHFR 734 R S C + Q+++T++HA +H H+R Sbjct: 36 RCSRCQKKTCQQTTTRVHAAMHLVIRIHWR 65 >SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) Length = 617 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +2 Query: 518 SPSRLSTESPVPRSKSPIRHTVETVTTKITKSAA---PRGESPKQRPENDKPDNVPGY 682 SP+ T P +S S + + +T +K AA P +PK E P N P Y Sbjct: 408 SPAAAKTSGPPAKSASNHKCSPAKPSTPASKDAAAKPPTSPAPKPEDEATGPPNKPSY 465 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,235,435 Number of Sequences: 59808 Number of extensions: 412287 Number of successful extensions: 1828 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1820 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2359470773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -