BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00044 (905 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56628| Best HMM Match : Actin (HMM E-Value=0) 169 3e-42 SB_56| Best HMM Match : Actin (HMM E-Value=0) 169 4e-42 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 168 6e-42 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 168 6e-42 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 166 2e-41 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 4e-33 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 128 8e-30 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 121 9e-28 SB_54| Best HMM Match : Actin (HMM E-Value=0) 113 2e-25 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 112 3e-25 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 79 6e-15 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 69 5e-12 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 51 1e-06 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 44 2e-04 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 42 7e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 41 0.001 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 40 0.004 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 39 0.005 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 38 0.008 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.008 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 38 0.008 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 38 0.011 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 38 0.011 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.011 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 38 0.011 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 38 0.015 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 38 0.015 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 38 0.015 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 38 0.015 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 38 0.015 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 37 0.019 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 37 0.019 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 37 0.019 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 37 0.026 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 37 0.026 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 37 0.026 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.034 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.034 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.034 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.034 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.034 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.034 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.034 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 36 0.034 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 36 0.034 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) 36 0.034 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.045 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) 36 0.045 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.045 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 36 0.045 SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) 36 0.045 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.045 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 36 0.045 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 36 0.045 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 36 0.045 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 36 0.045 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 36 0.045 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.060 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.060 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.060 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 36 0.060 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.060 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.060 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.060 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.060 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.060 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.060 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.060 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.060 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.060 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.060 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.060 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.060 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.060 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.060 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.060 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.060 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 36 0.060 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.060 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.060 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.060 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.060 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 36 0.060 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.060 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 169 bits (411), Expect = 3e-42 Identities = 82/84 (97%), Positives = 82/84 (97%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF Sbjct: 166 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 225 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 QEM TAASSSSLEKSYELPDGQVI Sbjct: 226 QEMTTAASSSSLEKSYELPDGQVI 249 Score = 141 bits (341), Expect = 8e-34 Identities = 73/123 (59%), Positives = 81/123 (65%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMY Sbjct: 251 IGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGI 310 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW SKQE+DE P Sbjct: 311 ADRMQKEISALAPPTMKIKIIAPPER--KYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 862 SIV 870 SIV Sbjct: 369 SIV 371 Score = 133 bits (322), Expect = 2e-31 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 EHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV Sbjct: 101 EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 160 Query: 243 SHTVP 257 +HTVP Sbjct: 161 THTVP 165 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 169 bits (410), Expect = 4e-42 Identities = 82/84 (97%), Positives = 82/84 (97%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF Sbjct: 165 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 224 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 QEM TAASSSSLEKSYELPDGQVI Sbjct: 225 QEMQTAASSSSLEKSYELPDGQVI 248 Score = 141 bits (341), Expect = 8e-34 Identities = 73/123 (59%), Positives = 81/123 (65%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMY Sbjct: 250 IGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGI 309 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW SKQE+DE P Sbjct: 310 ADRMQKEITSLAPPTMKIKIIAPPER--KYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 862 SIV 870 SIV Sbjct: 368 SIV 370 Score = 133 bits (322), Expect = 2e-31 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 EHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV Sbjct: 100 EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 159 Query: 243 SHTVP 257 +HTVP Sbjct: 160 THTVP 164 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 168 bits (408), Expect = 6e-42 Identities = 81/84 (96%), Positives = 82/84 (97%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 IYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF Sbjct: 128 IYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 187 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 QEM TAASSSSLEKSYELPDGQVI Sbjct: 188 QEMQTAASSSSLEKSYELPDGQVI 211 Score = 141 bits (342), Expect = 6e-34 Identities = 73/123 (59%), Positives = 81/123 (65%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY Sbjct: 213 IGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 272 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW SKQE+DE P Sbjct: 273 ADRMQKEISALAPPTMKIKIIAPPER--KYSVWIGGSILASLSTFQQMWISKQEYDESGP 330 Query: 862 SIV 870 +IV Sbjct: 331 AIV 333 Score = 91.1 bits (216), Expect = 1e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +3 Query: 108 NREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVP 257 N + M +IMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVP Sbjct: 78 NWDDMEKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVP 127 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 168 bits (408), Expect = 6e-42 Identities = 81/84 (96%), Positives = 82/84 (97%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 IYEGYALPHAI+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF Sbjct: 166 IYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 225 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 QEM TAASSSSLEKSYELPDGQVI Sbjct: 226 QEMETAASSSSLEKSYELPDGQVI 249 Score = 141 bits (341), Expect = 8e-34 Identities = 73/123 (59%), Positives = 81/123 (65%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMY Sbjct: 251 IGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGI 310 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW SKQE+DE P Sbjct: 311 ADRMQKEITSLAPPTMKIKIIAPPER--KYSVWIGGSILASLSTFQQMWISKQEYDESGP 368 Query: 862 SIV 870 SIV Sbjct: 369 SIV 371 Score = 133 bits (322), Expect = 2e-31 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 EHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV Sbjct: 101 EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 160 Query: 243 SHTVP 257 +HTVP Sbjct: 161 THTVP 165 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 166 bits (403), Expect = 2e-41 Identities = 81/84 (96%), Positives = 82/84 (97%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL YVALDF Sbjct: 165 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFE 224 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 QEMATAA+SSSLEKSYELPDGQVI Sbjct: 225 QEMATAAASSSLEKSYELPDGQVI 248 Score = 139 bits (337), Expect = 2e-33 Identities = 72/123 (58%), Positives = 81/123 (65%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+ Sbjct: 250 IGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGI 309 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW SKQE+DE P Sbjct: 310 ADRMQKEISALAPPTMKIKIIAPPER--KYSVWIGGSILASLSTFQQMWISKQEYDESGP 367 Query: 862 SIV 870 SIV Sbjct: 368 SIV 370 Score = 133 bits (322), Expect = 2e-31 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 EHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV Sbjct: 100 EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 159 Query: 243 SHTVP 257 +HTVP Sbjct: 160 THTVP 164 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 138 bits (335), Expect = 4e-33 Identities = 72/123 (58%), Positives = 80/123 (65%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTV+SGGTTMY Sbjct: 224 IGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGL 283 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW SKQE+DE P Sbjct: 284 ADRMQKEISALAPSTMKIKIIAPPER--KYSVWIGGSILASLSTFQQMWISKQEYDESGP 341 Query: 862 SIV 870 +IV Sbjct: 342 AIV 344 Score = 134 bits (325), Expect = 7e-32 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 EHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV Sbjct: 101 EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGV 160 Query: 243 SHTVP 257 SHTVP Sbjct: 161 SHTVP 165 Score = 108 bits (260), Expect = 5e-24 Identities = 53/65 (81%), Positives = 56/65 (86%) Frame = +2 Query: 314 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFXQEMATAASSSSLEKSYELP 493 D + + I ERGYSFTTTAEREIVRDIKEKLCYVALDF QEM TAASSSS+EKSYELP Sbjct: 158 DGVSHTVPIYEERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELP 217 Query: 494 DGQVI 508 DGQVI Sbjct: 218 DGQVI 222 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 128 bits (308), Expect = 8e-30 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 IYEGYALPHAILRLDLAGRDLTDYLMK++TERGYSFTTTAEREIVRDIKEKLCYVALDF Sbjct: 44 IYEGYALPHAILRLDLAGRDLTDYLMKLMTERGYSFTTTAEREIVRDIKEKLCYVALDFY 103 Query: 437 QEM 445 QE+ Sbjct: 104 QEI 106 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 129 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVP 257 IMFE FN+PA+YVAIQAVLSLYASGRTTG+V DSGDGVSH VP Sbjct: 1 IMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDGVSHNVP 43 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 121 bits (291), Expect = 9e-28 Identities = 63/123 (51%), Positives = 75/123 (60%), Gaps = 3/123 (2%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDLY+N VLSGG+TM+ Sbjct: 24 IGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSGGSTMFPGI 83 Query: 691 PTVCKRKXXXXXXXXXXXXXXXXXEEVLRMDRWIDSRF---LSNFQQMWXSKQEFDEXXP 861 +++ E + WI LS FQQMW +K+E+ E P Sbjct: 84 ADRMQKEIAMLANASMKVKVIAPPER--KYSVWIGGSILASLSTFQQMWIAKEEYHEYGP 141 Query: 862 SIV 870 IV Sbjct: 142 PIV 144 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 455 ASSSSLEKSYELPDGQVI 508 A+S LEK+YELPDGQVI Sbjct: 5 ANSPILEKTYELPDGQVI 22 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 113 bits (272), Expect = 2e-25 Identities = 49/84 (58%), Positives = 65/84 (77%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 +Y+GY LPHA R+DLAGRDLT YL +++TERGYSF +TAE++I+RD+KE LCY A+D+ Sbjct: 2210 VYDGYWLPHATQRIDLAGRDLTHYLQRLVTERGYSFQSTAEQQIIRDLKETLCYCAMDYE 2269 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 +E+ A +S E Y LPDGQ I Sbjct: 2270 RELKEAETSDDCEAPYMLPDGQSI 2293 Score = 113 bits (271), Expect = 2e-25 Identities = 50/65 (76%), Positives = 57/65 (87%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 + PVLLTEAPLNPK NRE+M Q+MFE+FN P MYVA+QAV++LYASGRTTG V D GDGV Sbjct: 2145 DFPVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMALYASGRTTGTVFDCGDGV 2204 Query: 243 SHTVP 257 SHTVP Sbjct: 2205 SHTVP 2209 Score = 70.9 bits (166), Expect = 1e-12 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 666 IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D+R +L+ N VLSG Sbjct: 2295 IGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 112 bits (270), Expect = 3e-25 Identities = 47/65 (72%), Positives = 60/65 (92%) Frame = +3 Query: 63 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 242 +HPVLLTEAPLNP+ NREK ++ FETFN PA+++++QAVLSLYA+GRTTG+VLD+GDGV Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDGV 185 Query: 243 SHTVP 257 SH+VP Sbjct: 186 SHSVP 190 Score = 64.1 bits (149), Expect = 1e-10 Identities = 27/51 (52%), Positives = 41/51 (80%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEK 409 IYEG+A+PH+I+R D+AGRD++ YL +L + G+ F +++E EIVR IKE+ Sbjct: 191 IYEGFAMPHSIMRTDIAGRDVSRYLRLLLRKEGHCFHSSSELEIVRTIKEE 241 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/26 (53%), Positives = 22/26 (84%) Frame = +1 Query: 604 SIMKCDVDIRKDLYANTVLSGGTTMY 681 +I K D+D+R+ LY+N VLSGG+T++ Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLF 289 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 98.7 bits (235), Expect = 6e-21 Identities = 44/84 (52%), Positives = 60/84 (71%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 +YEG+ALPH RLD+AGRD+T YL+K++ RGY+F TA+ E VR +KEKLCYV + Sbjct: 169 VYEGFALPHLTRRLDIAGRDITKYLIKLMLLRGYAFNHTADFETVRMMKEKLCYVGYNIE 228 Query: 437 QEMATAASSSSLEKSYELPDGQVI 508 QE A ++ L + Y LPDG+V+ Sbjct: 229 QEQKLALETTVLVEQYTLPDGRVV 252 Score = 89.4 bits (212), Expect = 3e-18 Identities = 40/66 (60%), Positives = 49/66 (74%) Frame = +3 Query: 60 REHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDG 239 R VLLTE PLNP NREKM ++MFE + +Y+AIQAVL+LYA G TG+V+DSGDG Sbjct: 103 RNTKVLLTEPPLNPMKNREKMIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGDG 162 Query: 240 VSHTVP 257 V+H P Sbjct: 163 VTHICP 168 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYLES 690 + ERF PEALFQP + +E G+ E +N+I D+D R + Y + VLSGG+TMY Sbjct: 254 LSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGL 313 Query: 691 PTVCKRK 711 P+ +R+ Sbjct: 314 PSRLERE 320 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/91 (40%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Frame = +2 Query: 239 CLPHRAIYEGYALPHAILRLDLAGRDLTDYLMKILTE-RGYSFTTTAEREIVRDIKEKLC 415 C IYEG+ L H + L++ G LT+ L + L + RG++FT+++ +IV DIKEK+C Sbjct: 789 CTQAAVIYEGHTLNHTLQTLEIGGHHLTENLKQYLRDQRGHNFTSSSGWQIVNDIKEKIC 848 Query: 416 YVALDFXQEMATAASSSSLEKSYELPDGQVI 508 Y++ D +E+ ++ L K Y LPDGQ+I Sbjct: 849 YLSKDHLKEVHNYKTNEGLTKFYTLPDGQMI 879 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 174 QAVLSLYASGRTTGIVLDSG 233 Q LSLYASG T G+ L SG Sbjct: 767 QLSLSLYASGMTLGVCLSSG 786 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/64 (43%), Positives = 46/64 (71%) Frame = +3 Query: 66 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 245 HP+L++EA N + REK+T++MFE +N PA ++ +VL+ +A+GR+ G+V+DSG + Sbjct: 34 HPLLMSEAAWNTRIKREKLTELMFEKYNVPAFFLCKNSVLTAFANGRSNGLVIDSGATQT 93 Query: 246 HTVP 257 VP Sbjct: 94 SAVP 97 Score = 31.5 bits (68), Expect = 0.97 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 565 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 678 G A G+ + S+ D+DIR L+ + +++GG T+ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTL 183 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +1 Query: 511 IGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 681 + ERF PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ Sbjct: 198 VAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/64 (31%), Positives = 33/64 (51%) Frame = +2 Query: 257 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFX 436 + EGY + I + +AGRD+T ++ ++L ER E + IKE+ Y+ D Sbjct: 78 VAEGYVIGSCIKHIPIAGRDITFFVQQLLREREMGIPPEQSMETAKTIKERWGYICPDIA 137 Query: 437 QEMA 448 +E A Sbjct: 138 KEFA 141 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 141 TFNTPAMYVAIQAVLSLYASGRT-TGIVLDSGDGVSHTVP 257 ++ T A+ + S RT TG V+DSGDGV+H +P Sbjct: 38 SYATKAVLALAASWTSRQVGERTLTGCVIDSGDGVTHVIP 77 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 707 GNHSSRPIDNED*DHCSSRRKYSVWIGGSILASSLTF 817 G +PI+ + H R Y+VW GGS+LAS+ F Sbjct: 283 GRIKPKPIETQVISHHMQR--YAVWFGGSMLASTPEF 317 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 2/46 (4%) Frame = -2 Query: 142 VSNMIWVIFSLLALGLRGASVSRTG--CSLVPNSCSPGDPLVLERP 11 + +++V+FS++ L ++ + G + + NSCSPGDPLVLERP Sbjct: 22 IKKLLFVLFSIVGLPVKILASKTAGDVIAFISNSCSPGDPLVLERP 67 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S SR G LV NSCSPGDPLVLERP Sbjct: 9 SRSRPGRLLVSNSCSPGDPLVLERP 33 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 CS V NSCSPGDPLVLERP Sbjct: 11 CSFVSNSCSPGDPLVLERP 29 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C LV NSCSPGDPLVLERP Sbjct: 3 CMLVSNSCSPGDPLVLERP 21 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/47 (51%), Positives = 29/47 (61%) Frame = -2 Query: 151 VLNVSNMIWVIFSLLALGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 +LN W +++ L A VSRT L+ NSCSPGDPLVLERP Sbjct: 35 LLNPRWFRWFNDKAISMWLVLAPVSRT---LLSNSCSPGDPLVLERP 78 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/61 (45%), Positives = 34/61 (55%) Frame = -2 Query: 193 YSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGASVSRTGCSLVPNSCSPGDPLVLER 14 Y ST W M VL + ++W F L++ G+ A R S NSCSPGDPLVLER Sbjct: 390 YGISTCWYC--MVSVL--TGIVWYEFLLVSYGIN-AYWYRMVSS---NSCSPGDPLVLER 441 Query: 13 P 11 P Sbjct: 442 P 442 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -2 Query: 82 VSRTGCSLVPNSCSPGDPLVLERP 11 +++TG + NSCSPGDPLVLERP Sbjct: 1 MAKTGITTTSNSCSPGDPLVLERP 24 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 25 SRSTVSISLISNSCSPGDPLVLERP 49 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S S SL+ NSCSPGDPLVLERP Sbjct: 23 SRSTVSISLISNSCSPGDPLVLERP 47 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -2 Query: 106 ALGLRGASVSRTGCSLVP---NSCSPGDPLVLERP 11 A L A G SLVP NSCSPGDPLVLERP Sbjct: 7 ACELNYADNGTNGASLVPRPSNSCSPGDPLVLERP 41 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -2 Query: 133 MIWVIFSLLALGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 +IW LL L L+ A+ SR G S NSCSPGDPLVLERP Sbjct: 10 VIWSKQELL-LRLKFAASSRGGRS---NSCSPGDPLVLERP 46 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -2 Query: 94 RGASVSRTGCSLVPNSCSPGDPLVLERP 11 RG+ + ++ NSCSPGDPLVLERP Sbjct: 2410 RGSDTGGSSSAIASNSCSPGDPLVLERP 2437 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 154 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP 252 PP P P + TRP VP +T PTP Sbjct: 919 PPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTP 951 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 79 SRTGCSLVPNSCSPGDPLVLERP 11 S SL+ NSCSPGDPLVLERP Sbjct: 28 STVSISLISNSCSPGDPLVLERP 50 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/22 (81%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -2 Query: 73 TGCS-LVPNSCSPGDPLVLERP 11 TGC L NSCSPGDPLVLERP Sbjct: 2 TGCEPLASNSCSPGDPLVLERP 23 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -2 Query: 91 GASVSRTGCSLVPNSCSPGDPLVLERP 11 G + S T ++ NSCSPGDPLVLERP Sbjct: 36 GLTKSTTESTITSNSCSPGDPLVLERP 62 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 5/63 (7%) Frame = -2 Query: 184 STAWMATYMAGVLNVSNMIWVIFSLLALGLR--GAS---VSRTGCSLVPNSCSPGDPLVL 20 + A ++ G+ NV+ + V LLAL + G S V + L+ NSCSPGDPLVL Sbjct: 24 AVACFLCFLLGITNVTQVRTVENFLLALFVNHVGRSCEVVYQHFPCLISNSCSPGDPLVL 83 Query: 19 ERP 11 ERP Sbjct: 84 ERP 86 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C V NSCSPGDPLVLERP Sbjct: 5 CEAVSNSCSPGDPLVLERP 23 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 82 VSRTGCSLVPNSCSPGDPLVLERP 11 +S+ C NSCSPGDPLVLERP Sbjct: 5 ISKNRCVTSSNSCSPGDPLVLERP 28 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +3 Query: 12 GRSRTSGSPGLQEF-GTREHPVLLTEAPLNP 101 GRSRTSGSPGLQEF G + H + + E+ L P Sbjct: 77 GRSRTSGSPGLQEFDGGQTHTIQVAESALAP 107 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 SL+ NSCSPGDPLVLERP Sbjct: 32 SLISNSCSPGDPLVLERP 49 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 +R S R L NSCSPGDPLVLERP Sbjct: 8 VRAQSNVREAAPLASNSCSPGDPLVLERP 36 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = -2 Query: 133 MIWVIFSLLALGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 ++ +IF +A+ + ++++ V NSCSPGDPLVLERP Sbjct: 9 LLIIIFIFIAIIVVVSAINIICICTVSNSCSPGDPLVLERP 49 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 79 SRTGCSLVPNSCSPGDPLVLERP 11 S T ++ NSCSPGDPLVLERP Sbjct: 11 STTSAPVISNSCSPGDPLVLERP 33 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/29 (68%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 94 RGASVSRTGCSLVP-NSCSPGDPLVLERP 11 R A + T LVP NSCSPGDPLVLERP Sbjct: 16 RFAKIPFTTLPLVPSNSCSPGDPLVLERP 44 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 73 TGCSLVPNSCSPGDPLVLERP 11 T LV NSCSPGDPLVLERP Sbjct: 20 TRAHLVSNSCSPGDPLVLERP 40 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S+V NSCSPGDPLVLERP Sbjct: 346 SIVSNSCSPGDPLVLERP 363 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 91 GASVSRTGCSLVPNSCSPGDPLVLERP 11 G R G NSCSPGDPLVLERP Sbjct: 9 GRGYLRRGSQTASNSCSPGDPLVLERP 35 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -2 Query: 88 ASVSRTGCSLVP-NSCSPGDPLVLERP 11 A + TG S P NSCSPGDPLVLERP Sbjct: 8 AKKTETGRSACPSNSCSPGDPLVLERP 34 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 +R +V + L NSCSPGDPLVLERP Sbjct: 76 MRKLAVDASNLLLTSNSCSPGDPLVLERP 104 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 R G + + NSCSPGDPLVLERP Sbjct: 57 RHGSNFLSNSCSPGDPLVLERP 78 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 82 VSRTGCSLVPNSCSPGDPLVLERP 11 + + G + NSCSPGDPLVLERP Sbjct: 22 IQKKGAKEISNSCSPGDPLVLERP 45 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -2 Query: 88 ASVSRTGCSLVPNSCSPGDPLVLERP 11 A+V R + NSCSPGDPLVLERP Sbjct: 13 AAVERPSVASQSNSCSPGDPLVLERP 38 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/30 (70%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -2 Query: 94 RGASV-SRTGCSL-VPNSCSPGDPLVLERP 11 RG SV SR G NSCSPGDPLVLERP Sbjct: 2 RGVSVESRVGVRTPTSNSCSPGDPLVLERP 31 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 + +R L+ NSCSPGDPLVLERP Sbjct: 16 AATRVRFPLISNSCSPGDPLVLERP 40 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/40 (52%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = -2 Query: 124 VIFSLLALGLRGASVSRT--GCSLVPNSCSPGDPLVLERP 11 ++F+ L L R A S V NSCSPGDPLVLERP Sbjct: 17 LVFACLQLNRRTAQTSSPLQPSENVSNSCSPGDPLVLERP 56 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 +R S+ G SL NSCSPGDPLVLERP Sbjct: 11 VRDTSILSAGRSL-SNSCSPGDPLVLERP 38 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -2 Query: 103 LGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 L G S+S + NSCSPGDPLVLERP Sbjct: 877 LAATGPSLSHPFPLVTSNSCSPGDPLVLERP 907 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 LV NSCSPGDPLVLERP Sbjct: 3 LVSNSCSPGDPLVLERP 19 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C + NSCSPGDPLVLERP Sbjct: 87 CIVTSNSCSPGDPLVLERP 105 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C + NSCSPGDPLVLERP Sbjct: 8 CVFLSNSCSPGDPLVLERP 26 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 12 GRSRTSGSPGLQEFGTREHP 71 GRSRTSGSPGLQEF T+ P Sbjct: 10 GRSRTSGSPGLQEFDTKNQP 29 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 LV NSCSPGDPLVLERP Sbjct: 9 LVSNSCSPGDPLVLERP 25 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 LV NSCSPGDPLVLERP Sbjct: 2 LVSNSCSPGDPLVLERP 18 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 91 GASVSRTGCSLVPNSCSPGDPLVLERP 11 G V G V NSCSPGDPLVLERP Sbjct: 20 GVIVKPEGNKDVSNSCSPGDPLVLERP 46 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 SV G + NSCSPGDPLVLERP Sbjct: 42 SVEAAGGTASSNSCSPGDPLVLERP 66 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C V NSCSPGDPLVLERP Sbjct: 12 CWQVSNSCSPGDPLVLERP 30 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 L A++ G NSCSPGDPLVLERP Sbjct: 8 LISANIRLRGICAASNSCSPGDPLVLERP 36 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 70 GCSLVPNSCSPGDPLVLERP 11 G +V NSCSPGDPLVLERP Sbjct: 3 GEGIVSNSCSPGDPLVLERP 22 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 SL NSCSPGDPLVLERP Sbjct: 14 SLTSNSCSPGDPLVLERP 31 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 70 GCSLVPNSCSPGDPLVLERP 11 G ++ NSCSPGDPLVLERP Sbjct: 23 GSLIISNSCSPGDPLVLERP 42 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 17 LISNSCSPGDPLVLERP 33 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S++R ++ NSCSPGDPLVLERP Sbjct: 29 SLARPYDNIASNSCSPGDPLVLERP 53 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 37 LISNSCSPGDPLVLERP 53 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 ++G L NSCSPGDPLVLERP Sbjct: 2 QSGLFLPSNSCSPGDPLVLERP 23 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C + NSCSPGDPLVLERP Sbjct: 53 CRVPSNSCSPGDPLVLERP 71 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 70 GCSLVPNSCSPGDPLVLERP 11 G L NSCSPGDPLVLERP Sbjct: 75 GILLTSNSCSPGDPLVLERP 94 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 ++V NSCSPGDPLVLERP Sbjct: 76 TIVSNSCSPGDPLVLERP 93 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 70 GCSLVPNSCSPGDPLVLERP 11 G ++ NSCSPGDPLVLERP Sbjct: 30 GIGVLSNSCSPGDPLVLERP 49 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C + NSCSPGDPLVLERP Sbjct: 157 CEVGSNSCSPGDPLVLERP 175 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/63 (33%), Positives = 26/63 (41%) Frame = +1 Query: 211 PVSCWTPATVSPTPCHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRAGNR 390 P + T + T + R R PR P RS + PHR L HRRAG+R Sbjct: 370 PTAQPTAQVIYHTAPYFRHHRVIPRRPGEIRPRSEHTQYVERYPHRRML----HRRAGHR 425 Query: 391 S*H 399 H Sbjct: 426 LRH 428 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 8 LISNSCSPGDPLVLERP 24 >SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -2 Query: 94 RGASVSRTGCSLVPNSCSPGDPLVLERP 11 RG VS T + NSCSPGDPLVLERP Sbjct: 3 RGVQVSGTHM-MGSNSCSPGDPLVLERP 29 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 40 LISNSCSPGDPLVLERP 56 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C + NSCSPGDPLVLERP Sbjct: 12 CGELSNSCSPGDPLVLERP 30 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 R C + NSCSPGDPLVLERP Sbjct: 4 RLWCYELSNSCSPGDPLVLERP 25 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -2 Query: 73 TGCSLVPNSCSPGDPLVLERP 11 T S NSCSPGDPLVLERP Sbjct: 8 TNVSYTSNSCSPGDPLVLERP 28 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 ++V NSCSPGDPLVLERP Sbjct: 12 NIVSNSCSPGDPLVLERP 29 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 21 LISNSCSPGDPLVLERP 37 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C NSCSPGDPLVLERP Sbjct: 2 CIFASNSCSPGDPLVLERP 20 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 16 LISNSCSPGDPLVLERP 32 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 LR ++ G L NSCSPGDPLVLERP Sbjct: 201 LRYYGSAQNGKHLRSNSCSPGDPLVLERP 229 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/40 (52%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = -2 Query: 121 IFSLLALGLRGASVSRTGC---SLVPNSCSPGDPLVLERP 11 I L LG G++ +R S NSCSPGDPLVLERP Sbjct: 491 ILKLWRLGESGSASARESVPSSSTPSNSCSPGDPLVLERP 530 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 70 GCSLVPNSCSPGDPLVLERP 11 G S NSCSPGDPLVLERP Sbjct: 2 GLSTQSNSCSPGDPLVLERP 21 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S V NSCSPGDPLVLERP Sbjct: 13 SQVSNSCSPGDPLVLERP 30 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -2 Query: 154 GVLNVSNMIWVIFSLLALG---LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 GV +S W L +G R ++ ++ NSCSPGDPLVLERP Sbjct: 85 GVQGLSGKGWKARPLTEMGRSLCRQLVRAKNQKEIISNSCSPGDPLVLERP 135 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C NSCSPGDPLVLERP Sbjct: 35 CFYTSNSCSPGDPLVLERP 53 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 L A++ + + NSCSPGDPLVLERP Sbjct: 8 LISANIPKLKLLITSNSCSPGDPLVLERP 36 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 SL NSCSPGDPLVLERP Sbjct: 3 SLSSNSCSPGDPLVLERP 20 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +++ NSCSPGDPLVLERP Sbjct: 12 NIISNSCSPGDPLVLERP 29 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +L+ NSCSPGDPLVLERP Sbjct: 1 TLLSNSCSPGDPLVLERP 18 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C+ NSCSPGDPLVLERP Sbjct: 3 CASSSNSCSPGDPLVLERP 21 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 11 MVSNSCSPGDPLVLERP 27 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -2 Query: 121 IFSLLALGLRGASVSRTGCSLVP--NSCSPGDPLVLERP 11 ++S A RG S ++ P NSCSPGDPLVLERP Sbjct: 36 VYSARARSPRGQRQSENLRTIPPVSNSCSPGDPLVLERP 74 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 ++V NSCSPGDPLVLERP Sbjct: 18 TVVSNSCSPGDPLVLERP 35 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 CSL NSCSPGDPLVLERP Sbjct: 6 CSL-SNSCSPGDPLVLERP 23 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 SL NSCSPGDPLVLERP Sbjct: 5 SLSSNSCSPGDPLVLERP 22 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 85 IVSNSCSPGDPLVLERP 101 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S V NSCSPGDPLVLERP Sbjct: 15 SKVSNSCSPGDPLVLERP 32 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -2 Query: 73 TGC-SLVPNSCSPGDPLVLERP 11 T C S+ NSCSPGDPLVLERP Sbjct: 2 TQCWSVTSNSCSPGDPLVLERP 23 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = -2 Query: 163 YMAGVLNVSNMIWVIFSLLALGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 YM VS + + + G+ G S ++ NSCSPGDPLVLERP Sbjct: 75 YMTSSYEVSGWSTLYYMTSSYGVSGWSTF-----ILSNSCSPGDPLVLERP 120 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +++ NSCSPGDPLVLERP Sbjct: 3 TIISNSCSPGDPLVLERP 20 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = -2 Query: 208 VRPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGASVSR-----TGCSLVPNSC 44 +R + Y A M +L + + WV F L+A+ + + L NSC Sbjct: 608 IRFEHYGSEQAAGLKGMVVLLPLLGLTWV-FGLMAVDEKTIAFQYIFAILNSLQLASNSC 666 Query: 43 SPGDPLVLERP 11 SPGDPLVLERP Sbjct: 667 SPGDPLVLERP 677 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = -2 Query: 157 AGVLNVSNMIWVIFSLLALGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 AG V+ + V ++ +V+ V NSCSPGDPLVLERP Sbjct: 160 AGAKAVAGAVAVAVAVAVAVAVAVAVAVAVAVAVSNSCSPGDPLVLERP 208 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +++ NSCSPGDPLVLERP Sbjct: 12 NIISNSCSPGDPLVLERP 29 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S+ NSCSPGDPLVLERP Sbjct: 18 SITSNSCSPGDPLVLERP 35 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C NSCSPGDPLVLERP Sbjct: 7 CYKTSNSCSPGDPLVLERP 25 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 74 DWVFPRAEFLQPGGSTSSRA 15 D+++P EFLQPGGSTSSRA Sbjct: 109 DFIYPGIEFLQPGGSTSSRA 128 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 17 IISNSCSPGDPLVLERP 33 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -2 Query: 112 LLALGLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 L+ + + GAS+ + + NSCSPGDPLVLERP Sbjct: 2 LMRVTVAGASIVQQ----ISNSCSPGDPLVLERP 31 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 100 GLRGASVSRTGCSLVPNSCSPGDPLVLERP 11 GLR L NSCSPGDPLVLERP Sbjct: 1007 GLRSMGAHVFVVGLGSNSCSPGDPLVLERP 1036 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +L NSCSPGDPLVLERP Sbjct: 14 ALTSNSCSPGDPLVLERP 31 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 R ++ NSCSPGDPLVLERP Sbjct: 16 RNSSNISSNSCSPGDPLVLERP 37 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S + NSCSPGDPLVLERP Sbjct: 57 SSISNSCSPGDPLVLERP 74 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 88 ASVSRTGCSLVPNSCSPGDPLVLERP 11 AS+SR NSCSPGDPLVLERP Sbjct: 56 ASLSRLQRQGRSNSCSPGDPLVLERP 81 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 94 RGASVSRTGCSLVPNSCSPGDPLVLERP 11 R A S V NSCSPGDPLVLERP Sbjct: 1054 RSAKKSELEEKEVSNSCSPGDPLVLERP 1081 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 94 RGASVSRTGCSLVPNSCSPGDPLVLERP 11 R ++ SRT L NSCSPGDPLVLERP Sbjct: 6 RKSNASRT---LRSNSCSPGDPLVLERP 30 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 3474 VVSNSCSPGDPLVLERP 3490 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 + G L NSCSPGDPLVLERP Sbjct: 22 KPGKHLPSNSCSPGDPLVLERP 43 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S + NSCSPGDPLVLERP Sbjct: 2 SQISNSCSPGDPLVLERP 19 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 14 IISNSCSPGDPLVLERP 30 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +L NSCSPGDPLVLERP Sbjct: 5 TLASNSCSPGDPLVLERP 22 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 7 VVSNSCSPGDPLVLERP 23 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 54 LLSNSCSPGDPLVLERP 70 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 + V NSCSPGDPLVLERP Sbjct: 17 AFVSNSCSPGDPLVLERP 34 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -2 Query: 73 TGCSL-VPNSCSPGDPLVLERP 11 T CS + NSCSPGDPLVLERP Sbjct: 26 TICSYRISNSCSPGDPLVLERP 47 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 6 LLSNSCSPGDPLVLERP 22 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 5 IISNSCSPGDPLVLERP 21 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +++ NSCSPGDPLVLERP Sbjct: 4 NVISNSCSPGDPLVLERP 21 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 + G V NSCSPGDPLVLERP Sbjct: 26 KEGKIAVSNSCSPGDPLVLERP 47 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 1 MISNSCSPGDPLVLERP 17 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 82 VSRTGCSLVPNSCSPGDPLVLERP 11 ++ T + NSCSPGDPLVLERP Sbjct: 2 LTNTLAQITSNSCSPGDPLVLERP 25 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 1 LLSNSCSPGDPLVLERP 17 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L+ NSCSPGDPLVLERP Sbjct: 7 LLSNSCSPGDPLVLERP 23 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +L NSCSPGDPLVLERP Sbjct: 2 TLASNSCSPGDPLVLERP 19 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 +V NSCSPGDPLVLERP Sbjct: 27 VVSNSCSPGDPLVLERP 43 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S + NSCSPGDPLVLERP Sbjct: 4 SKISNSCSPGDPLVLERP 21 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +L NSCSPGDPLVLERP Sbjct: 95 ALASNSCSPGDPLVLERP 112 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 70 GCSLVPNSCSPGDPLVLERP 11 G + NSCSPGDPLVLERP Sbjct: 49 GFRVASNSCSPGDPLVLERP 68 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 R G NSCSPGDPLVLERP Sbjct: 4 RGGARYRSNSCSPGDPLVLERP 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S NSCSPGDPLVLERP Sbjct: 12 SFTSNSCSPGDPLVLERP 29 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +++ NSCSPGDPLVLERP Sbjct: 12 NILSNSCSPGDPLVLERP 29 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 2 VSNSCSPGDPLVLERP 17 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -2 Query: 82 VSRTGCSLVPNSCSPGDPLVLERP 11 +S++ + NSCSPGDPLVLERP Sbjct: 1 MSQSSPITISNSCSPGDPLVLERP 24 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 40 VSNSCSPGDPLVLERP 55 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 117 VSNSCSPGDPLVLERP 132 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 184 VSNSCSPGDPLVLERP 199 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 34 VSNSCSPGDPLVLERP 49 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 14 VISNSCSPGDPLVLERP 30 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 76 RTGCSLVPNSCSPGDPLVLERP 11 R S NSCSPGDPLVLERP Sbjct: 60 RRKSSTTSNSCSPGDPLVLERP 81 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 214 VSNSCSPGDPLVLERP 229 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 32 VSNSCSPGDPLVLERP 47 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 5 LASNSCSPGDPLVLERP 21 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 5 VSNSCSPGDPLVLERP 20 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 64 VSNSCSPGDPLVLERP 79 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/33 (60%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = -2 Query: 100 GLRGASVSRTGCSLVP---NSCSPGDPLVLERP 11 G+R V++ G L P NSCSPGDPLVLERP Sbjct: 1177 GMRRPQVTK-GNDLKPFASNSCSPGDPLVLERP 1208 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 11 VSNSCSPGDPLVLERP 26 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 25 VSNSCSPGDPLVLERP 40 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 17 LASNSCSPGDPLVLERP 33 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 6 VSNSCSPGDPLVLERP 21 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 37 LTSNSCSPGDPLVLERP 53 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 18 VSNSCSPGDPLVLERP 33 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 82 VSRTGCSLVPNSCSPGDPLVLERP 11 V R+ ++ NSCSPGDPLVLERP Sbjct: 16 VVRSRKTISSNSCSPGDPLVLERP 39 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -2 Query: 79 SRTGCSLVPNSCSPGDPLVLERP 11 +R + NSCSPGDPLVLERP Sbjct: 14 NRLDLTFTSNSCSPGDPLVLERP 36 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 L A+++ + NSCSPGDPLVLERP Sbjct: 8 LISANINTQSKLVASNSCSPGDPLVLERP 36 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/31 (67%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -2 Query: 100 GLRGASVSRTGC-SLVPNSCSPGDPLVLERP 11 GLR +V R C S NSCSPGDPLVLERP Sbjct: 13 GLR--AVRRDCCRSRGSNSCSPGDPLVLERP 41 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 14 VSNSCSPGDPLVLERP 29 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 11 LASNSCSPGDPLVLERP 27 >SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 12 GRSRTSGSPGLQEFGTREH 68 GRSRTSGSPGLQEF + H Sbjct: 10 GRSRTSGSPGLQEFDVKHH 28 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 23 VSNSCSPGDPLVLERP 38 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 18 VSNSCSPGDPLVLERP 33 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 11 LASNSCSPGDPLVLERP 27 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -2 Query: 79 SRTGCSLVPNSCSPGDPLVLERP 11 S TG S NSCSPGDPLVLERP Sbjct: 90 SATGIS--SNSCSPGDPLVLERP 110 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 27 VSNSCSPGDPLVLERP 42 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 9 VSNSCSPGDPLVLERP 24 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 17 VSNSCSPGDPLVLERP 32 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 79 SRTGCSLVPNSCSPGDPLVLERP 11 SR C NSCSPGDPLVLERP Sbjct: 23 SRCSCQS-SNSCSPGDPLVLERP 44 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 25 VISNSCSPGDPLVLERP 41 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 L NSCSPGDPLVLERP Sbjct: 4 LASNSCSPGDPLVLERP 20 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/22 (72%), Positives = 18/22 (81%), Gaps = 2/22 (9%) Frame = -2 Query: 70 GCSLVP--NSCSPGDPLVLERP 11 G + +P NSCSPGDPLVLERP Sbjct: 177 GTTTIPPSNSCSPGDPLVLERP 198 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 12 NIASNSCSPGDPLVLERP 29 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 5 ISNSCSPGDPLVLERP 20 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 101 ISNSCSPGDPLVLERP 116 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 97 LRGASVSRTGCSLVPNSCSPGDPLVLERP 11 LR +S +L NSCSPGDPLVLERP Sbjct: 8 LRIEFLSNPPKNLRSNSCSPGDPLVLERP 36 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 261 ISNSCSPGDPLVLERP 276 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S+ NSCSPGDPLVLERP Sbjct: 110 SVESNSCSPGDPLVLERP 127 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +L NSCSPGDPLVLERP Sbjct: 22 ALSSNSCSPGDPLVLERP 39 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S NSCSPGDPLVLERP Sbjct: 12 STASNSCSPGDPLVLERP 29 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C NSCSPGDPLVLERP Sbjct: 26 CRSRSNSCSPGDPLVLERP 44 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 10 ISNSCSPGDPLVLERP 25 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 3 ISNSCSPGDPLVLERP 18 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 55 ILSNSCSPGDPLVLERP 71 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 13 ISNSCSPGDPLVLERP 28 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 52 ISNSCSPGDPLVLERP 67 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 51 ISNSCSPGDPLVLERP 66 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 16 ISNSCSPGDPLVLERP 31 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 152 ISNSCSPGDPLVLERP 167 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 47 ISNSCSPGDPLVLERP 62 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 7 ISNSCSPGDPLVLERP 22 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 67 CSLVPNSCSPGDPLVLERP 11 C+L NSCSPGDPLVLERP Sbjct: 9 CAL-SNSCSPGDPLVLERP 26 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 32 ISNSCSPGDPLVLERP 47 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 12 NITSNSCSPGDPLVLERP 29 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S + NSCSPGDPLVLERP Sbjct: 5 SQLSNSCSPGDPLVLERP 22 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 16 ALELVDPPGCRNSARGN 66 ALELVDPPGCRNS GN Sbjct: 29 ALELVDPPGCRNSIDGN 45 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 18 ISNSCSPGDPLVLERP 33 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 +++ NSCSPGDPLVLERP Sbjct: 18 TVLSNSCSPGDPLVLERP 35 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 974 ISNSCSPGDPLVLERP 989 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 6 ISNSCSPGDPLVLERP 21 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 3 TIASNSCSPGDPLVLERP 20 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 61 LVPNSCSPGDPLVLERP 11 ++ NSCSPGDPLVLERP Sbjct: 65 MLSNSCSPGDPLVLERP 81 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 64 SLVPNSCSPGDPLVLERP 11 S+ NSCSPGDPLVLERP Sbjct: 3 SIGSNSCSPGDPLVLERP 20 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +1 Query: 16 ALELVDPPGCRNSARGNT 69 ALELVDPPGCRNS R T Sbjct: 12 ALELVDPPGCRNSIRSTT 29 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 1 ISNSCSPGDPLVLERP 16 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 58 VPNSCSPGDPLVLERP 11 + NSCSPGDPLVLERP Sbjct: 5 ISNSCSPGDPLVLERP 20 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -2 Query: 85 SVSRTGCSLVPNSCSPGDPLVLERP 11 S R G NSCSPGDPLVLERP Sbjct: 22 SSKRQGGVTGSNSCSPGDPLVLERP 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,311,110 Number of Sequences: 59808 Number of extensions: 763115 Number of successful extensions: 5271 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5221 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -