BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00042 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 2.0 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 2.6 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 2.6 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 3.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.6 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 308 DFVRNVLVNNSHNSIMKSLRIKL 376 DF + VNNS N+ M + RI L Sbjct: 481 DFTYKITVNNSGNNRMGTCRIFL 503 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 174 VRIFKETIVCLLCFFFC 224 VR K TI+ +L FF C Sbjct: 271 VRTLKMTIIIVLVFFVC 287 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 174 VRIFKETIVCLLCFFFC 224 VR K TI+ +L FF C Sbjct: 271 VRTLKMTIIIVLVFFVC 287 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.2 bits (45), Expect = 3.5 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 175 FEYLKKP-LSVYCVFFFVKI*FWRFCLQNIVIF 270 FE +P L Y +F FV + FW L + F Sbjct: 85 FECDNEPKLRHYLIFIFVNVFFWVIILMSNYAF 117 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 458 QLLRNVHIISCISLYGILGRYWQ 390 +LLR H I +S + YWQ Sbjct: 380 ELLRRFHEIRYMSTIDLRSSYWQ 402 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,232 Number of Sequences: 336 Number of extensions: 3581 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -