BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00041 (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 27 0.61 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 26 1.1 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 26 1.1 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 1.4 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 24 4.3 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 24 4.3 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 24 4.3 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 24 4.3 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 24 4.3 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 24 4.3 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 4.3 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 24 4.3 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 4.3 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 5.7 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 23 5.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.5 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 7.5 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 10.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 10.0 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 10.0 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 26.6 bits (56), Expect = 0.61 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = +3 Query: 84 SPGEALRRLMEAVAGGLLLEHGPGLRDPCEKELVDAL--GNMP--PQKREDLTAXAQQXL 251 +PG A+ + A LL G R E+EL AL GN P+ ++DL QQ Sbjct: 60 APGNAVISPLSVKALLALLYEGSASRSETERELQQALSGGNSQAVPKLQDDLLQYKQQQQ 119 Query: 252 RRLL 263 + LL Sbjct: 120 QNLL 123 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.8 bits (54), Expect = 1.1 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = -2 Query: 196 PSASTSSFSQGSRRPGPCSSNRPPATASMSLRSASPGDRAAPADCTTPAVSSSI 35 P+AS+S+ S S +P P + +A + S S R P +T A SSS+ Sbjct: 8 PTASSSTTSSSSSKPSP-QQQQQLHSADVPHSSTSQSSR-RPQHSSTSASSSSV 59 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.8 bits (54), Expect = 1.1 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = -2 Query: 196 PSASTSSFSQGSRRPGPCSSNRPPATASMSLRSASPGDRAAPADCTTPAVSSSI 35 P+AS+S+ S S +P P + +A + S S R P +T A SSS+ Sbjct: 8 PTASSSTTSSSSSKPSP-QQQQQLHSADVPHSSTSQSSR-RPQHSSTSASSSSV 59 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 25.4 bits (53), Expect = 1.4 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 9/85 (10%) Frame = +3 Query: 129 GLLLEHGPG--LRDPCEKELVDALGNMPPQKREDL----TAXAQQXLRR---LLSGKFIR 281 G +LE G +RD E+EL+D ++ P+K L A +R+ + F Sbjct: 405 GQVLERGEEEPVRDVNEQELLDIASSLNPRKAPGLDGVPNAALTAAIRKHTDIFKKLFQE 464 Query: 282 CSTWSRSPRRTRNGRLEVPAQPGAP 356 C R P + +L + +PG P Sbjct: 465 CLDNERFPDEWKKQKLALIPKPGKP 489 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAHC 136 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAHC 136 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAHC 136 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAHC 136 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAHC 136 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.8 bits (49), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAHC 136 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 4.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 508 RHRYRWNLVMYM 543 RH+ RW+ VMYM Sbjct: 352 RHKKRWSQVMYM 363 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.8 bits (49), Expect = 4.3 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -2 Query: 196 PSASTSSFSQGSRRPGPCSSNRPPATASMSLRSASPGDRAAPADCTTP 53 P+A+T+ + S + PAT S + P AAPA P Sbjct: 229 PAAATAHAATASPVATAALAAGAPATVSTPMDKDDPAAAAAPATAEVP 276 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.8 bits (49), Expect = 4.3 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNRPPATASMSLR 101 G +PSAS S Q S +P S TAS S R Sbjct: 134 GSIPSASLSQRQQSSPQPSMASVVANGDTASTSHR 168 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.4 bits (48), Expect = 5.7 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 140 EQQAAGDGLHEPPQRLAGRQSGARGLHHAGRQQFHCV*VERRPV 9 EQ+ PP R GR++ R L R+Q V ERR + Sbjct: 1119 EQRGRRHPTPSPPPRAVGRRAEVRSLGERYRRQLLVV-EERRQI 1161 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.4 bits (48), Expect = 5.7 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = -2 Query: 343 CAGTSRRPLRVRLGERLHVEHLMNLPESNLLKXCCAXAVRSSRFCGGMLPSASTSS 176 C G RR +R GE+ H LP +L C + G P+A ++ Sbjct: 444 CCGPDRRDCCLRGGEKGHFAATCRLPPRCVL---CPDGSNAHHSSGAFCPAAKKTA 496 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 130 PPATASMSLRSASPGDRAAPADCTTPAVSSSIAY 29 PP TA S +SPG + P PAV +++ + Sbjct: 1207 PPGTAPNSFHKSSPGRGSWPG----PAVENTLGH 1236 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.5 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 205 GMLPSASTSSFSQGSRRPGPCSSNR--PPATASMSLRSASPGDRAAPADC 62 G+ P+A + QG R GP S R P + L AS PA C Sbjct: 87 GLAPNARSLFELQGMRHKGPFESCRDEPSKMSGKYLLRASNDVEPFPAYC 136 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.6 bits (46), Expect = 10.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 530 RFQRYRCLWLSIHKG 486 RF+ +R W+SI KG Sbjct: 314 RFEVHRYCWMSIQKG 328 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.6 bits (46), Expect = 10.0 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 335 SRATRRSNTDNEHDAPNGEGKIVKTEEK 418 + AT+ + D H+A G++ KT+ + Sbjct: 1462 ANATKNTARDLHHEADQLNGRLAKTDNR 1489 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 60 VQSAGAALSPGEALRRLMEAVAGGLLLE 143 ++ + A S GE + ++ A GG+LLE Sbjct: 137 MKQSDALKSVGETISKVRRAQNGGMLLE 164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,120 Number of Sequences: 2352 Number of extensions: 12752 Number of successful extensions: 44 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -