BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00039 (423 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.46 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.1 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 21 5.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 20 10.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 20 10.0 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.6 bits (51), Expect = 0.46 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -2 Query: 200 IHNVNTCDSFSYNTDLGQFRSNSTSNF 120 IHN N ++ +YN + + +N+ +N+ Sbjct: 323 IHNNNNYNNNNYNNNYNNYNNNNYNNY 349 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 351 DFFLISFLVLIFASCLVRALRIARVFLALKSKA 253 DF + S L + C++ +F AL+++A Sbjct: 342 DFIIYSSLSSFYIPCIIMVFLYYNIFKALRNRA 374 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.0 bits (42), Expect = 5.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 223 LETTTKTRNTSFRFKSQED 279 L+TT+ +NT +FK E+ Sbjct: 52 LKTTSPFKNTEIKFKLGEE 70 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.2 bits (40), Expect = 10.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 269 AKKTRAMRKALTKHE 313 AKK R++ LT HE Sbjct: 755 AKKARSVNHLLTHHE 769 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.2 bits (40), Expect = 10.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 59 KGAIQTA*GAKDRINKSS 112 KG+I GA+D NK++ Sbjct: 190 KGSISNIDGAEDHCNKTA 207 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,682 Number of Sequences: 438 Number of extensions: 1304 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10873896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -