BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00037 (386 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0) 78 3e-15 SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026) 42 2e-04 SB_17127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.57 SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) 29 1.3 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_52318| Best HMM Match : Pox_A32 (HMM E-Value=0.066) 27 4.0 SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 27 4.0 SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) 27 4.0 SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) 27 5.3 SB_12592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_42699| Best HMM Match : SIR2 (HMM E-Value=1.6e-12) 27 7.1 SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) 27 7.1 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) 26 9.3 >SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0) Length = 113 Score = 77.8 bits (183), Expect = 3e-15 Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 2/85 (2%) Frame = +2 Query: 17 SKMVNVPKQRRTYXXXXXXXXXXXE--SQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIF 190 S +VNVPKQR+T+ +QYK K AQG+RRYDRKQ G+GGQ+KP+F Sbjct: 6 SPVVNVPKQRKTFCKGKKCRRHTLHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVF 65 Query: 191 XXXXXXXXXIVLRLECADCKVNHRL 265 IVLR+EC CK ++ Sbjct: 66 HKKAKTTKKIVLRMECTQCKYRKQM 90 Score = 54.4 bits (125), Expect = 3e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +1 Query: 259 QVALKRCKHFELGGDKKRKGQMIQF 333 Q+ LKRCKHFELGGDKKRKGQMIQF Sbjct: 89 QMPLKRCKHFELGGDKKRKGQMIQF 113 >SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026) Length = 39 Score = 41.9 bits (94), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 259 QVALKRCKHFELGGDKKRK 315 Q+ LKRCKHFELGGDKKRK Sbjct: 21 QMPLKRCKHFELGGDKKRK 39 >SB_17127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 0.57 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 293 SSKCLHLFNATCDSPCNLHTQDGAQF 216 SSKCLH+ N D P NL + A+F Sbjct: 38 SSKCLHVINEDIDIPSNLPSSMSAKF 63 >SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) Length = 519 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 326 IICPFLFLSPPSSKCLHLFNATCDSPCNL 240 ++C L PPSS+CL + + PCNL Sbjct: 454 MMCVNLDDRPPSSQCLQALQTSEEKPCNL 482 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 28.7 bits (61), Expect = 1.8 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +3 Query: 6 AERTQKW*TYQNSAGRTAKNVNATKYTRNHSTKSPRKGTLPRVEDVMIVNSRVTVVSPNP 185 AE +W T + + +K + + K R T P + D+ +R+T VSP Sbjct: 1021 AESFHRWLTQRQFCAQYSKELASGKTNREWVTALPIV-----ISDINATKTRMTGVSPKD 1075 Query: 186 SSKRRQKPLR 215 + K R+ PL+ Sbjct: 1076 AIKLRRVPLK 1085 >SB_52318| Best HMM Match : Pox_A32 (HMM E-Value=0.066) Length = 716 Score = 27.5 bits (58), Expect = 4.0 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 164 NPAVYDHNVFYPGQRAFPWTF-CTVIPCVLCGIYIFCSTSCA 42 +P + DH VFYP P TF T+ P + I ++ ST+ A Sbjct: 167 HPILNDHGVFYPKALPHPLTFEITLAP--VSDIVVYSSTTPA 206 >SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1359 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 164 NPAVYDHNVFYPGQRAFPWTFCTVIPCVLCGIYIFCSTSCA 42 +P + DH VFYP P TF + + I ++ ST+ A Sbjct: 1172 HPILNDHGVFYPKALPHPLTF-EITLATVSDIVVYSSTTPA 1211 >SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) Length = 1725 Score = 27.5 bits (58), Expect = 4.0 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 164 NPAVYDHNVFYPGQRAFPWTF-CTVIPCVLCGIYIFCSTSCA 42 +P + DH VFYP P TF T+ P + I ++ ST+ A Sbjct: 1243 HPILNDHGVFYPKALPHPLTFEITLAP--VSDIVVYSSTTQA 1282 >SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 27.1 bits (57), Expect = 5.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 253 ESQVALKRCKHFELGGDKKR 312 +S++A RC H LGGD +R Sbjct: 495 QSRIASPRCAHRPLGGDSRR 514 >SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) Length = 303 Score = 27.1 bits (57), Expect = 5.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 346 LEAFKIGSSVPFSSCHHRAQSACI 275 +E + +G S+ + C H SACI Sbjct: 261 MEEYAVGDSMKYLPCRHNFHSACI 284 >SB_12592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.1 bits (57), Expect = 5.3 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = +3 Query: 30 TYQNSAGRTAKNVNATKYTRNHSTKSPR----KGTLPRVEDV--MIVNSRVTVVSPNPSS 191 T +S G + T +T K+ R G RV+++ ++ R T+ PN S Sbjct: 43 TSTSSRGARTQTTAETSFTTEGRCKAKRLQAVDGVTERVQELQGVVATDRETIDDPNTSE 102 Query: 192 KRRQK 206 RRQ+ Sbjct: 103 SRRQE 107 >SB_42699| Best HMM Match : SIR2 (HMM E-Value=1.6e-12) Length = 501 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 104 KSKERHAAQGRRRYDRKQQGY 166 K K+RHA Q YD+K Q Y Sbjct: 471 KQKDRHARQLGINYDKKHQNY 491 >SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) Length = 399 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -1 Query: 140 VFYPGQRAFPWTFCTVIPCVLCGIYIFCSTSCAVLV 33 VFYP P V+ C+ + + C C +LV Sbjct: 105 VFYPPSNGLPVFTLLVMDCLCFTLLVMCYLCCTLLV 140 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 26.2 bits (55), Expect = 9.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 36 QNSAGRTAKNVNATKYTRNHSTKSPRKGT 122 QNS TA+N + +K R HS P K T Sbjct: 83 QNSVSSTAQNGSKSKRKRKHSELDPVKYT 111 >SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) Length = 521 Score = 26.2 bits (55), Expect = 9.3 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +3 Query: 54 TAKNVNATKYTRNHSTKS---PRKGTLPRVEDVMIVNSRVTVVSPNPSSKRRQ 203 T K + T+ T+ T++ P + T PR+ I +R+T P S R Q Sbjct: 460 TRKRITLTRITQTRITRTRIIPTRITKPRITRTRITKTRITRKIPITSGCRLQ 512 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,522,412 Number of Sequences: 59808 Number of extensions: 249589 Number of successful extensions: 1054 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -