BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00030 (814 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.5 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.5 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.9 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 63 WVDNLLLNTFFTALRQAFIF 4 +++++ LNT++ LRQAF F Sbjct: 223 FIEDIGLNTYYFFLRQAFPF 242 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 63 WVDNLLLNTFFTALRQAFIF 4 +++++ LNT++ LRQAF F Sbjct: 223 FIEDIGLNTYYFFLRQAFPF 242 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 260 D*LNLRKDLSASVSACRSARE 198 D LNLR D+S+S S+ S+ E Sbjct: 363 DILNLRTDISSSSSSISSSEE 383 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 90 QGSVYVQQEASRHH--ACQPYPGNENCFG 170 Q S+Y+QQ+ +HH + + N+ FG Sbjct: 94 QHSLYLQQQQQQHHQDSSSEHASNQERFG 122 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 226 DAERSFRKFS*SPNMCKDVMCSATSTAWTSQPI 324 DA+ S + +S + + K+ A +W +PI Sbjct: 579 DAKSSVQNYSLAKHQLKEAFVKAHLGSWVKKPI 611 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,880 Number of Sequences: 438 Number of extensions: 4452 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -