BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00016 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 25 1.7 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.0 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 118 RWQVSLCWASDWRFIYNSLT*RLC 189 RWQ+ +CW S F+ +L C Sbjct: 383 RWQLYMCWVSGSLFVVPALIISAC 406 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.4 bits (48), Expect = 7.0 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = -1 Query: 397 SSNYSVEIHKHHYAQGQFQCHQHQHEDRVGDKHAVALPDGTAASE 263 + NY + H+ Q Q Q QH+HE + +A AS+ Sbjct: 895 AENYRQQ-HQQQQQQQQQQQQQHEHEQQQQQNSMLATQQRLEASQ 938 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 728,359 Number of Sequences: 2352 Number of extensions: 15868 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -