BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00015 (612 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40426-5|AAF99947.1| 191|Caenorhabditis elegans Rho gdi protein... 83 2e-16 U36431-1|AAD10299.1| 191|Caenorhabditis elegans Rho GDP dissoci... 83 2e-16 >U40426-5|AAF99947.1| 191|Caenorhabditis elegans Rho gdi protein 1 protein. Length = 191 Score = 83.0 bits (196), Expect = 2e-16 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +1 Query: 13 HMVGSYPPKIEIQSYTTPPEDAPSGMMARGSYSVNSLFTDDDKNVHLQWEWSFEIKKD 186 +M+GSY PK+EIQ Y +P E+APSGMM RG Y V S TDDD NV+L W+W+ I K+ Sbjct: 134 YMMGSYAPKLEIQEYKSPNEEAPSGMMHRGKYKVYSKITDDDNNVYLDWQWTLHITKE 191 >U36431-1|AAD10299.1| 191|Caenorhabditis elegans Rho GDP dissociation inhibitor protein. Length = 191 Score = 83.0 bits (196), Expect = 2e-16 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +1 Query: 13 HMVGSYPPKIEIQSYTTPPEDAPSGMMARGSYSVNSLFTDDDKNVHLQWEWSFEIKKD 186 +M+GSY PK+EIQ Y +P E+APSGMM RG Y V S TDDD NV+L W+W+ I K+ Sbjct: 134 YMMGSYAPKLEIQEYKSPNEEAPSGMMHRGKYKVYSKITDDDNNVYLDWQWTLHITKE 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,909,385 Number of Sequences: 27780 Number of extensions: 274004 Number of successful extensions: 697 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -