BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00014 (781 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1344 - 25912639-25914060 29 5.5 08_02_0704 + 20197529-20197601,20197720-20198062,20198194-201982... 28 7.2 >07_03_1344 - 25912639-25914060 Length = 473 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 284 AGEPPLPATDPAWHRFHHLRMRLSVT 207 A P LPAT P R H +RL+VT Sbjct: 5 AARPVLPATPPKLRRHHAAALRLTVT 30 >08_02_0704 + 20197529-20197601,20197720-20198062,20198194-20198262, 20199341-20199479,20199727-20199786 Length = 227 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 583 HF*LESLEALSG-CVCHS*ANHLSLSNDGP 497 HF ++S + G CV HS N+ L N GP Sbjct: 87 HFDMQSANTIEGKCVVHSFKNYTKLDNVGP 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,751,031 Number of Sequences: 37544 Number of extensions: 192998 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -