BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00001 (615 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 26 0.22 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.2 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 26.2 bits (55), Expect = 0.22 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 Query: 105 LPRCQRWRYPQWPWHLENYMSQPPTKLPRSPPSSKRGSLEPRP 233 +P C W + + PPT PR S+R PRP Sbjct: 228 VPECADWYKGRLTDEQLKELENPPTPKPRPTKVSRRKPRPPRP 270 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 324 PSPQPGCSSSHNTSDTITNAQDTTVSSRSAL 232 P PQ S+ NTS + TN+ S + L Sbjct: 419 PQPQITSPSNTNTSTSSTNSNKPNSSDLNML 449 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,157 Number of Sequences: 336 Number of extensions: 3139 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -