SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP14_F_I16
         (652 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    23   2.6  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    23   2.6  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    23   2.6  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    23   2.6  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    23   2.6  
X72577-1|CAA51169.1|  283|Apis mellifera Apidaecin precursor pro...    23   3.4  
DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    23   3.4  
M29490-1|AAA27725.1|  109|Apis mellifera protein ( Bee homeobox-...    22   4.5  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   5.9  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    22   5.9  
AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      22   5.9  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    21   7.8  

>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 90  NNYNYNNNYNNY 101


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 323 NNYNYNNNYNNY 334


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 146 NKYNYGNKYDTY 111
           N YNY N Y+ Y
Sbjct: 323 NNYNYNNNYNNY 334


>X72577-1|CAA51169.1|  283|Apis mellifera Apidaecin precursor
           protein.
          Length = 283

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 363 SQPRPPAPTMR 331
           SQPRPP P +R
Sbjct: 106 SQPRPPHPRLR 116



 Score = 22.6 bits (46), Expect = 3.4
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 363 SQPRPPAPTMR 331
           SQPRPP P +R
Sbjct: 162 SQPRPPHPRLR 172


>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = -2

Query: 456 KNCRFKFDSSIVSISTICNFLKPI 385
           K C +  DSS V  S + +F  P+
Sbjct: 188 KKCSYNMDSSYVIFSAMGSFFLPM 211


>M29490-1|AAA27725.1|  109|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone E30. ).
          Length = 109

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +2

Query: 431 LSNLNRQFLFRRNDIGLPKAKCAVEFVNKR 520
           L+   RQ L R  D+GL +A+  + F NKR
Sbjct: 45  LTERRRQQLSR--DLGLTEAQIKIWFQNKR 72


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 590 FHIVVCGLDSI 622
           FH+ V GLDSI
Sbjct: 65  FHVTVMGLDSI 75


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -3

Query: 143 KYNYGNKYD 117
           KYNY NKY+
Sbjct: 97  KYNYNNKYN 105


>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -2

Query: 363 SQPRPPAPTMRTLQQFMMKFRI 298
           S P P  PT  T+QQ + + +I
Sbjct: 155 SLPTPVTPTPTTVQQLLRRAQI 176


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = +2

Query: 467 NDIGLPKAKCAVEFVNKRVPGCEAVAH 547
           NDI L K +  ++F +K  P C    H
Sbjct: 256 NDIALLKTEKDIKFGDKVGPACLPFQH 282


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,419
Number of Sequences: 438
Number of extensions: 3840
Number of successful extensions: 41
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19682733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -