SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP14_F_I14
         (651 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    24   1.1  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    23   2.6  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    23   2.6  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   2.6  

>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +1

Query: 85  FKVIVRNFSSSSAMQSAIKNVTVIGGGLM-GSGIAQVSAQAGQNVTLVDV 231
           FKV+V     S     A+KN+   G G + G G+   +  A   + L+++
Sbjct: 188 FKVVVVEDVDSVECCGALKNIVACGAGFIDGLGLGDNTKAAVMRLGLMEI 237


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +3

Query: 144 CNGYWRW 164
           CNG WRW
Sbjct: 55  CNGLWRW 61


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +3

Query: 144 CNGYWRW 164
           CNG WRW
Sbjct: 93  CNGLWRW 99


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +1

Query: 259 KSIGTNLSRVAKKMYKDNPQE 321
           +SI  N + + KK+ +DNP E
Sbjct: 588 RSITRNATALIKKLCRDNPAE 608


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.316    0.129    0.341 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,110
Number of Sequences: 438
Number of extensions: 3512
Number of successful extensions: 10
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19682733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)

- SilkBase 1999-2023 -