SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP14_F_D13
         (303 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              21   3.3  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    21   4.4  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    20   7.7  

>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 21.0 bits (42), Expect = 3.3
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -1

Query: 105 RKLHCYVFCL 76
           R+L CY++CL
Sbjct: 67  RQLKCYMYCL 76


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 20.6 bits (41), Expect = 4.4
 Identities = 13/50 (26%), Positives = 22/50 (44%)
 Frame = +3

Query: 150 C*LKVLRHDKDLSLTNKYKNXDSAYGNCDFYXALICSVRV*C*KLHKKKH 299
           C L+ LR    + L  +    D    + D+     C+V +   KLH++ H
Sbjct: 403 CLLETLRMYPPVPLIAREIKTDLKLASGDYTIPAGCTVVIGTFKLHRQPH 452


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 19.8 bits (39), Expect = 7.7
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -1

Query: 48  IYLKERPY*C 19
           I+ KERPY C
Sbjct: 141 IHTKERPYKC 150


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,327
Number of Sequences: 438
Number of extensions: 1166
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  6368931
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -