Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP13_F_C24
         (648 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    23   3.4  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    23   3.4  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    23   3.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   4.4  

>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 153 KTATTNPGPGGV 188
           KTA  NPGP GV
Sbjct: 326 KTARENPGPPGV 337


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 153 KTATTNPGPGGV 188
           KTA  NPGP GV
Sbjct: 326 KTARENPGPPGV 337


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 153 KTATTNPGPGGV 188
           KTA  NPGP GV
Sbjct: 265 KTARENPGPPGV 276


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 9/36 (25%), Positives = 21/36 (58%)
 Frame = -3

Query: 496  PVSSSSNSLNAFMISSLVSFSAIFTDMSSIKSSNDT 389
            P+S+++  +  + +  + S   I+T  + I SS++T
Sbjct: 1106 PLSAANGVITGYKVIVIPSGGGIYTKDTKITSSSET 1141


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,374
Number of Sequences: 438
Number of extensions: 3155
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)