Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP13_F_C06
         (647 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    23   2.5  
AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    23   2.5  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    21   7.8  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    21   7.8  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    21   7.8  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    21   7.8  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    21   7.8  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   7.8  

>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = -3

Query: 306 SVRCNEYLMSSTSDSKECQLICGVHIPGLLSKLSNKPS 193
           S R ++ L+    D+  C   CG+  PG  + LSN+ S
Sbjct: 71  STRYDKRLLPPVQDADFC---CGMRWPGDATGLSNRSS 105


>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 8/26 (30%), Positives = 17/26 (65%)
 Frame = +1

Query: 133 VNHEGIPIKSSLDNATSVLYAGLIGQ 210
           + H+G PI+  +   T ++ AG++G+
Sbjct: 574 LTHKGKPIRMRIGIHTGMVLAGVVGK 599


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 404 KTI*NNFNYKLTY 366
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 404 KTI*NNFNYKLTY 366
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 404 KTI*NNFNYKLTY 366
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 404 KTI*NNFNYKLTY 366
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 404 KTI*NNFNYKLTY 366
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 404 KTI*NNFNYKLTY 366
           KTI NN NYK  Y
Sbjct: 321 KTIHNNNNYKYNY 333


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,921
Number of Sequences: 438
Number of extensions: 4265
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)