SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP12_F_M04
         (369 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    21   6.1  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    21   6.1  

>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 20.6 bits (41), Expect = 6.1
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -3

Query: 202 SAPVLVCFSRANN 164
           S P+L CF RA N
Sbjct: 172 SPPLLGCFPRATN 184


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 20.6 bits (41), Expect = 6.1
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = -1

Query: 204 YQHQS*SVFQEPITDL*LLEFCLGLPMISTRAVSHHML 91
           YQ Q    F+EP+      E  +GL  +  R + +  L
Sbjct: 74  YQIQQCGKFKEPVAVFYASEIAIGLFFLHGRGIVYRDL 111


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,353
Number of Sequences: 438
Number of extensions: 1870
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8804355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -