Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP12_F_C24
         (606 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ217660-1|ABB29845.1| 1759|Homo sapiens castor long variant pro...    32   1.4  

>DQ217660-1|ABB29845.1| 1759|Homo sapiens castor long variant
           protein.
          Length = 1759

 Score = 32.3 bits (70), Expect = 1.4
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = -1

Query: 225 VGRRAHGPPDGVWLPSSMDYSNARGRAKPLPTVLFCSISIQTSTARHGPYQVSLXRI--G 52
           VG+   G P G+ LPSS  +   +    PLP+    S+ +Q   AR   Y   + ++  G
Sbjct: 265 VGKEVVGTPPGLRLPSSTAHLETKATILPLPS--HSSVQMQNLVARASKYDFFIQKLKTG 322

Query: 51  PALLASSGS 25
             L   +GS
Sbjct: 323 ENLRPQNGS 331


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,683,090
Number of Sequences: 237096
Number of extensions: 1546618
Number of successful extensions: 2767
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2767
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6410414940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)