BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fprWP11_F_E11
(616 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizo... 26 3.8
>SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein
Vps1|Schizosaccharomyces pombe|chr 1|||Manual
Length = 678
Score = 26.2 bits (55), Expect = 3.8
Identities = 14/43 (32%), Positives = 24/43 (55%)
Frame = +2
Query: 290 IPVSVAVSDIIKYINEHEQEDCLLVGFSSQKVNPFREKSSCTV 418
+P S+++ +IKY EH Q + L + SQ + ++S TV
Sbjct: 614 VPKSISLK-MIKYSKEHIQHELLEQLYKSQAFDKLLQESEVTV 655
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,209,535
Number of Sequences: 5004
Number of extensions: 38009
Number of successful extensions: 77
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 74
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 269634532
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -