BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fprWP10_F_M19
(401 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC106084-1|AAI06085.1| 202|Homo sapiens HSF1 protein protein. 30 3.3
>BC106084-1|AAI06085.1| 202|Homo sapiens HSF1 protein protein.
Length = 202
Score = 29.9 bits (64), Expect = 3.3
Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 5/57 (8%)
Frame = +3
Query: 198 PGYYSVPLHVDCSIEYE----LPD-CAKPPQGVKIEPLLMIHPSHFRRLESLRRVPF 353
P + VPL + +E E LPD AKP PL +H + +R L+ R+PF
Sbjct: 111 PTWAPVPLPISWPVELENKLLLPDKAAKPAPLPSAGPLPFLHQAEWRTLKLRDRLPF 167
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,773,478
Number of Sequences: 237096
Number of extensions: 852954
Number of successful extensions: 1705
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1661
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1705
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2928276690
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -