SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP10_F_I03
         (411 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ666693-1|ABG29167.1|  250|Apis mellifera MAX dimerization prot...    21   4.1  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    20   9.5  

>DQ666693-1|ABG29167.1|  250|Apis mellifera MAX dimerization protein
           protein.
          Length = 250

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 343 QLHLHSXHGIHG 308
           Q  LH  HG+HG
Sbjct: 131 QTGLHGLHGLHG 142



 Score = 21.0 bits (42), Expect = 5.4
 Identities = 8/12 (66%), Positives = 9/12 (75%), Gaps = 1/12 (8%)
 Frame = -3

Query: 340 LH-LHSXHGIHG 308
           LH LH  HG+HG
Sbjct: 134 LHGLHGLHGLHG 145


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 20.2 bits (40), Expect = 9.5
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = -3

Query: 307 TCCVHLNETHSVARYPKFLILMGLFSGISLIETISPVVFL 188
           T  V L++     R+   LI    F  ISL+  I  ++F+
Sbjct: 378 TSLVSLDKKQYTWRHTSVLIGWSAFLCISLVYIIMLIIFI 417


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,526
Number of Sequences: 438
Number of extensions: 1939
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10379628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -