BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fprWP09_F_N01
(327 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC031287-1|AAH31287.1| 145|Homo sapiens MRPL43 protein protein. 30 1.4
>BC031287-1|AAH31287.1| 145|Homo sapiens MRPL43 protein protein.
Length = 145
Score = 30.3 bits (65), Expect = 1.4
Identities = 12/31 (38%), Positives = 16/31 (51%)
Frame = +1
Query: 76 QGSNGGANIKPVARPSIHYHKGYCPFACREF 168
+G GG N P P + H +CP + REF
Sbjct: 2 RGGCGGGNDSPGRSPPVRGHTAHCPGSLREF 32
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.317 0.133 0.400
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,074,414
Number of Sequences: 237096
Number of extensions: 851928
Number of successful extensions: 8683
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8668
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8683
length of database: 76,859,062
effective HSP length: 79
effective length of database: 58,128,478
effective search space used: 1685725862
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
- SilkBase 1999-2023 -