Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP08_F_D08
         (655 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF043698-2|AAB97559.3|  700|Caenorhabditis elegans Hypothetical ...    29   3.8  

>AF043698-2|AAB97559.3|  700|Caenorhabditis elegans Hypothetical
           protein C54G6.2 protein.
          Length = 700

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 14/70 (20%)
 Frame = +3

Query: 384 FYRLCIEIVGKL----------FHVLAGKRHGELY--AIQDNELHQMNSN-ETKLFTIQI 524
           FY +C+EIVG L          F  L   R  E+Y  AI  N + Q N N   KL T  +
Sbjct: 268 FYEICLEIVGLLEECDRISFDEFETLCENRISEVYVEAIFQNAVEQGNINARLKLLTFSL 327

Query: 525 RLSG-R*KTK 551
             +G + KTK
Sbjct: 328 LFAGLQQKTK 337


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,078,326
Number of Sequences: 27780
Number of extensions: 249856
Number of successful extensions: 394
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 389
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 394
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1455289764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)