Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP08_F_C14
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    23   1.4  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    21   7.7  

>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.4
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = -3

Query: 288 SVMYNVAVPNS*SFMRSLVDGDCSNTPSAGSAKLLDTTTIVVLQY 154
           +V +NV   +     R  V GD  N P  G+A    T  ++VL +
Sbjct: 307 NVGFNVKNVSVKELRRGYVAGDSKNNPPKGAADF--TAQVIVLNH 349


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -2

Query: 187 T*HHYHCCTSVY 152
           T HH+H C  +Y
Sbjct: 469 TLHHWHHCPEIY 480


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,668
Number of Sequences: 438
Number of extensions: 2527
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)