SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP06_F_L19
         (523 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            24   2.7  
AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript...    24   2.7  
DQ974165-1|ABJ52805.1|  482|Anopheles gambiae serpin 5 protein.        23   6.2  
AY843205-1|AAX14774.1|  478|Anopheles gambiae odorant receptor O...    23   8.2  
AY363726-1|AAR14939.1|  331|Anopheles gambiae seven transmembran...    23   8.2  
AY363725-1|AAR14938.1|  478|Anopheles gambiae seven transmembran...    23   8.2  

>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 24.2 bits (50), Expect = 2.7
 Identities = 13/62 (20%), Positives = 30/62 (48%)
 Frame = +1

Query: 295  RGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVL 474
            R A   + LE    + +++L  +N  +  NF FG+     L ++++ +  +  ++ Y V 
Sbjct: 3256 RIAALSDELEESRHILQHKLYSNNSQSLNNFKFGLHTQEILPLQFNKASSMATINEYRVC 3315

Query: 475  GR 480
             +
Sbjct: 3316 SK 3317


>AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1168

 Score = 24.2 bits (50), Expect = 2.7
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -2

Query: 240 CIPRPWKIQAVVL 202
           C P+PWK Q +VL
Sbjct: 473 CFPQPWKKQRLVL 485


>DQ974165-1|ABJ52805.1|  482|Anopheles gambiae serpin 5 protein.
          Length = 482

 Score = 23.0 bits (47), Expect = 6.2
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = -1

Query: 277 QSFHYDGYQKTALYT*ALENTGCCPVSCSNTLAARVSLSP 158
           Q F  DG  + ++    +  +GC P   S  L AR+   P
Sbjct: 278 QPFFPDGEDQPSILVPTMFASGCFPYYSSPELQARIMAFP 317


>AY843205-1|AAX14774.1|  478|Anopheles gambiae odorant receptor
           Or83b protein.
          Length = 478

 Score = 22.6 bits (46), Expect = 8.2
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -3

Query: 212 LLSCELLQHLGG 177
           LL+CE LQHL G
Sbjct: 223 LLACEQLQHLKG 234


>AY363726-1|AAR14939.1|  331|Anopheles gambiae seven transmembrane G
           protein-coupledreceptor protein.
          Length = 331

 Score = 22.6 bits (46), Expect = 8.2
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -3

Query: 212 LLSCELLQHLGG 177
           LL+CE LQHL G
Sbjct: 76  LLACEQLQHLKG 87


>AY363725-1|AAR14938.1|  478|Anopheles gambiae seven transmembrane G
           protein-coupledreceptor protein.
          Length = 478

 Score = 22.6 bits (46), Expect = 8.2
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -3

Query: 212 LLSCELLQHLGG 177
           LL+CE LQHL G
Sbjct: 223 LLACEQLQHLKG 234


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 535,467
Number of Sequences: 2352
Number of extensions: 11068
Number of successful extensions: 29
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 47783067
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -