SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP05_F_J21
         (625 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0481 + 23284296-23284448,23284553-23284753,23284855-232879...    32   0.32 

>02_04_0481 + 23284296-23284448,23284553-23284753,23284855-23287971,
            23288510-23289353,23289468-23290120,23290573-23290676,
            23290898-23291000
          Length = 1724

 Score = 32.3 bits (70), Expect = 0.32
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 4/62 (6%)
 Frame = -2

Query: 519  IKYFSNQVKY----FSDFSYYFAHNYLKLHIMNLQLASKDLXDTEQ*H*FFLSECQNQQP 352
            ++  SNQ +Y    F D S Y   N   +H  +LQLAS  +  T + H    +E QN+  
Sbjct: 1198 VEQLSNQAEYLSEIFKDLSGYMDENITLVH-HSLQLASSKVAHTLEEHDTLRNELQNKDT 1256

Query: 351  HS 346
            H+
Sbjct: 1257 HN 1258


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,142,219
Number of Sequences: 37544
Number of extensions: 190127
Number of successful extensions: 379
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 379
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1513903616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -