Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP04_F_O03
         (425 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo...    29   0.40 

>SPAC343.11c |msc1||multi-copy suppressor of Chk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1588

 Score = 28.7 bits (61), Expect = 0.40
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +2

Query: 134 ALGGLHYGWYKLQSVDSLVPDKDRSRLPKWLQELGF*NINXKNKKTAVNVYRLMITLLI* 313
           +L G+HY  Y  Q +  ++P+ D  +  K L +L    I  K +    +   L I++LI 
Sbjct: 530 SLFGMHYHHYGAQRIWYVIPEVDGPKYEKLLNDLSPSFIQEKPETLIKSKILLPISMLIS 589

Query: 314 NYIML 328
           N I +
Sbjct: 590 NGIQV 594


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,488,745
Number of Sequences: 5004
Number of extensions: 26336
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 58
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 152416050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)