Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP04_F_M03
         (653 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT022153-1|AAY51548.1|  219|Drosophila melanogaster IP01409p pro...    30   3.2  

>BT022153-1|AAY51548.1|  219|Drosophila melanogaster IP01409p
           protein.
          Length = 219

 Score = 29.9 bits (64), Expect = 3.2
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 4/46 (8%)
 Frame = +3

Query: 417 PHLRHMHRXTYSXRCSPK----GSGCSKTCLRSSVQCHHCHCFLPH 542
           P ++ +H      R +PK    GS C ++  R + +C HC    PH
Sbjct: 41  PEMKVLHLIISKVRLTPKLALDGSECVRSGARMAYKCSHCSKSFPH 86


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,193,597
Number of Sequences: 53049
Number of extensions: 378394
Number of successful extensions: 1046
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 987
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1045
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2786177250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)