BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fprWP04_F_J05
(626 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.5
>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
polyprotein protein.
Length = 1726
Score = 23.8 bits (49), Expect = 4.5
Identities = 19/61 (31%), Positives = 29/61 (47%)
Frame = +2
Query: 389 QYSVFCNSTGRVNCGHFIEFISQILR*SLINTTNKLTADGILSHIT*EQTIFVGREISTS 568
QYSV + N F+E IL+ S N N+ +A+ I+ +T Q GR ++
Sbjct: 273 QYSVDFKTDEFTNLVEFLEQRVNILKSSAQNICNQYSANSIM--VTGRQARRDGRNVALP 330
Query: 569 V 571
V
Sbjct: 331 V 331
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 572,963
Number of Sequences: 2352
Number of extensions: 10544
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -