BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_H21 (384 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81463-5|CAB03853.1| 70|Caenorhabditis elegans Hypothetical pr... 70 5e-13 Z75550-9|CAE54924.1| 1291|Caenorhabditis elegans Hypothetical pr... 26 7.9 Z75550-8|CAA99926.1| 1307|Caenorhabditis elegans Hypothetical pr... 26 7.9 >Z81463-5|CAB03853.1| 70|Caenorhabditis elegans Hypothetical protein C06B8.8 protein. Length = 70 Score = 70.1 bits (164), Expect = 5e-13 Identities = 35/71 (49%), Positives = 47/71 (66%) Frame = +2 Query: 62 MPREIKDIKDFLINGEEERRQIGQNKEEPXXXXXXXXXXXXFLYTLVITDKEKAEKLKQS 241 MP+EIK+IKDFL+ + + + K+ +LYTLV+ DK+KAEKLKQS Sbjct: 1 MPKEIKEIKDFLVKARRKDAKSVKIKKNSNNTKFKVRCAS-YLYTLVVADKDKAEKLKQS 59 Query: 242 LPPGLQVKEVK 274 LPPG+QVKE+K Sbjct: 60 LPPGIQVKELK 70 >Z75550-9|CAE54924.1| 1291|Caenorhabditis elegans Hypothetical protein T22C1.10b protein. Length = 1291 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 188 GTLSIEALNLTFCRVLLYFDRFGVFPP 108 GTL T +LYFDRF +F P Sbjct: 149 GTLDGHVYFFTEQGTMLYFDRFSIFEP 175 >Z75550-8|CAA99926.1| 1307|Caenorhabditis elegans Hypothetical protein T22C1.10a protein. Length = 1307 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 188 GTLSIEALNLTFCRVLLYFDRFGVFPP 108 GTL T +LYFDRF +F P Sbjct: 165 GTLDGHVYFFTEQGTMLYFDRFSIFEP 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,091,324 Number of Sequences: 27780 Number of extensions: 100173 Number of successful extensions: 278 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 566277334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -