BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_H15 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) 281 3e-76 SB_24524| Best HMM Match : Proteasome (HMM E-Value=1.4013e-45) 74 9e-14 SB_4103| Best HMM Match : Proteasome (HMM E-Value=8.2e-05) 32 0.37 SB_15403| Best HMM Match : CH (HMM E-Value=0) 28 7.9 >SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) Length = 909 Score = 281 bits (690), Expect = 3e-76 Identities = 125/181 (69%), Positives = 154/181 (85%) Frame = +2 Query: 122 MSILXYNGGAVVAMKGQDCVAIATDKRFGIQAQTVSTNFPKVFQMGPTLYVGLPGLATDT 301 MSI+ YNG A++AM G++CVAIA D+R GIQAQTVS +F K+FQMG L+VGLPGLATD Sbjct: 71 MSIMEYNGAAIIAMVGKNCVAIAADRRLGIQAQTVSCDFQKIFQMGEKLFVGLPGLATDV 130 Query: 302 QTVFXRLKFXMNLYELKENRMMRPKTFSAMLSNLLYERRFGPYFIEPVIAGLXPYDNQPY 481 QT+ RLKF +NLYEL+E R ++PKTF +M+SNLLYERRFGPYF+EPVIAGL P N+P+ Sbjct: 131 QTISSRLKFRLNLYELREGRPIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDPKTNEPF 190 Query: 482 VCNMDLIGCPNEPEXFVVSGTCSEQLYGMCEALWEPNLKPDELFXTISQALVNAADXDAI 661 + +MDLIGCP E + FVVSGTCSEQ+YGMCE+LW P+L+PD+LF TISQAL+NA D DA+ Sbjct: 191 ISSMDLIGCPMETKDFVVSGTCSEQMYGMCESLWVPDLEPDDLFETISQALLNAVDRDAV 250 Query: 662 S 664 S Sbjct: 251 S 251 >SB_24524| Best HMM Match : Proteasome (HMM E-Value=1.4013e-45) Length = 291 Score = 74.1 bits (174), Expect = 9e-14 Identities = 45/148 (30%), Positives = 73/148 (49%) Frame = +2 Query: 116 TNMSILXYNGGAVVAMKGQDCVAIATDKRFGIQAQTVSTNFPKVFQMGPTLYVGLPGLAT 295 T S +NGG V+A+ G+D IA+D R Q + + PKV+++ + +G G Sbjct: 78 TYFSPYAFNGGTVLAISGEDFAVIASDTRLSQGFQIHTRDSPKVYKLTGSTVLGCSGFHG 137 Query: 296 DTQTVFXRLKFXMNLYELKENRMMRPKTFSAMLSNLLYERRFGPYFIEPVIAGLXPYDNQ 475 D T+ + + +YE + M + MLS +LY RRF PY+ ++AGL + + Sbjct: 138 DCLTLTKHISARLQMYEHDHGKAMSCTAIAQMLSTMLYYRRFFPYYTYNILAGLDS-EGK 196 Query: 476 PYVCNMDLIGCPNEPEXFVVSGTCSEQL 559 V + D +G E E + G+ S L Sbjct: 197 GCVFSFDPVG-SYEREVYRAGGSASALL 223 >SB_4103| Best HMM Match : Proteasome (HMM E-Value=8.2e-05) Length = 131 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +2 Query: 506 CPNEPEXFVVSGTCSEQLYGMCEALWEPNLKPDELFXTISQALVNAADXDAIS 664 C +P F + G+ S +YG C+A ++ + +E F + A+ A D S Sbjct: 51 CIRQP--FTIGGSGSTYIYGHCDATYKSGMSKEECFNFVKTAVALAMSRDGSS 101 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 190 YGQAVWYTSSNSINQLPKSIPNGTHIVCRPSRSRD*HPNCI 312 YGQ VWY + + ++ P +VC S RD C+ Sbjct: 1547 YGQCVWYYDGRTQCECRRTCPRSDQLVC-GSDDRDYANECV 1586 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,211,776 Number of Sequences: 59808 Number of extensions: 451936 Number of successful extensions: 878 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -