BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_H07 (627 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.8 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.4 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 2.8 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +2 Query: 26 WICVTFSRCSELKYLRKIV 82 WIC +RC +++ K++ Sbjct: 736 WICTLMNRCKFSEFMTKLL 754 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 2.8 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 287 RRSPGDARHRSH--CHILAEEWFYNSLAVQ 370 RR PG AR R H H++A F + ++ Sbjct: 329 RRGPGPARSRRHLPAHLVAGTCFVQLIGMR 358 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 177 KHRKLYSDEWALGDDEAEGGRGFSLAD 257 +H+K S EW + + G+ F L D Sbjct: 1527 EHKKKTSTEWIQVSNNVKLGQNFVLLD 1553 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,823 Number of Sequences: 336 Number of extensions: 2717 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -