BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_H03 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0127 - 926333-926359,926637-926708,926928-927032,927129-92... 33 0.15 09_06_0214 + 21616019-21616086,21616205-21616252,21616336-216164... 30 1.8 04_04_0919 - 29422003-29422267,29422411-29422660,29423163-294234... 30 1.8 02_05_0419 - 28814754-28816114,28816749-28817435,28817554-288177... 29 2.4 05_07_0247 + 28643862-28644310,28645151-28645207,28645644-286489... 29 3.2 06_03_0785 - 24563310-24565004,24565302-24565384,24565484-245660... 27 9.8 >02_01_0127 - 926333-926359,926637-926708,926928-927032,927129-927227, 927298-927381,927462-927518,927596-927671,927755-927807, 927899-927931,928100-928165,928556-928628,928721-928794, 929177-929237,929354-929536,929656-929703,929810-929868 Length = 389 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 504 IPDAVVGKFILISTATLFILTTLWINTYP---FLDEDSAVYELIPNPK 638 +PDA V +F I +F LW+N ++ D+ E+IPNPK Sbjct: 195 VPDAHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPK 242 >09_06_0214 + 21616019-21616086,21616205-21616252,21616336-21616427, 21616555-21616645,21617660-21617720,21617810-21617887, 21617979-21618029,21618118-21618191,21618306-21618378, 21618762-21618819,21618899-21618969,21619045-21619110, 21619327-21619359,21619445-21619497,21619572-21619647, 21619729-21619785,21619874-21619957,21620037-21620135, 21620260-21620364,21620575-21620643,21621019-21621108 Length = 498 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 504 IPDAVVGKFILISTATLFILTTLWINTYP---FLDEDSAVYELIPNPK 638 +PD V +F I +F LW+N ++ ++ E+IPNPK Sbjct: 284 VPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEAEALKMEIIPNPK 331 >04_04_0919 - 29422003-29422267,29422411-29422660,29423163-29423481, 29423625-29424794,29424879-29425388,29425449-29425607 Length = 890 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 393 LPFFTSVFSSKGFCFLALCIIFSTILGSA 307 LP TS F K FC + +IF T+ GSA Sbjct: 534 LPATTSPFKIKKFCLRSASLIFCTVSGSA 562 >02_05_0419 - 28814754-28816114,28816749-28817435,28817554-28817774, 28818536-28818750 Length = 827 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +2 Query: 338 QRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQD 439 +++KK+K + ++++KK E+ +L K++FQD Sbjct: 162 KKSKKRKGITASSDIKKEAEQYVLHAGSKRNFQD 195 >05_07_0247 + 28643862-28644310,28645151-28645207,28645644-28648950, 28649069-28649144,28649356-28649426,28649524-28649589, 28649677-28649766,28649874-28650050,28650513-28650548 Length = 1442 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 Query: 335 IQRAKKQKPLLENTEVKKGKEKSILFPEEKQSFQDFEKE 451 +QR K+Q L E +K KE S E K+ + FEKE Sbjct: 1097 VQRLKEQGSLRTEREREKDKEASRRLEETKERDKKFEKE 1135 >06_03_0785 - 24563310-24565004,24565302-24565384,24565484-24566039, 24566397-24566513,24566565-24567131,24568632-24568702, 24569833-24569903,24570270-24570441,24571229-24572212, 24573128-24574808 Length = 1998 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +3 Query: 456 FVXELHNYIKKYMYMDIPDAVVGKFILISTATLFILTTLWINTYPFL 596 FV +L Y+ DIP + T+F L + W NTYP + Sbjct: 1700 FVEKLKIYVDHLR--DIPKVAFNNMKQLKELTIFGLGSSWENTYPII 1744 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,447,443 Number of Sequences: 37544 Number of extensions: 253130 Number of successful extensions: 580 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -