BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_H03 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 31 0.024 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 3.6 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 31.5 bits (68), Expect = 0.024 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = +3 Query: 495 YMDIPDAVVGKFILISTATLFILTTLWINTYPFLDEDSAVYELIPNPKW 641 Y+D ++ +++ +A + ++ TLW+ TYP D + P W Sbjct: 258 YLDSVGSIEDLQLIVYSAAVAVVRTLWLRTYPQGDSEGRPCSKAEKPAW 306 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -1 Query: 274 ILVNFIIISCVVRFFTSTFVWMRNCLTC 191 +L+ F+ +S + T +WM+NC +C Sbjct: 323 LLILFLCVSILGTLITPE-LWMKNCKSC 349 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,807 Number of Sequences: 2352 Number of extensions: 11111 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -