BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G23 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 1.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.9 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 171 PFRWCISRKGHRPRES 218 PF+W +K R RES Sbjct: 323 PFKWLFKKKKRRNRES 338 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 1.9 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 380 GHAVGDIPGVR 412 G AVGD+PG+R Sbjct: 62 GTAVGDVPGLR 72 Score = 21.4 bits (43), Expect = 4.5 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = -3 Query: 429 TFTTLKRTPGMSPTA*PLRPNPAXSTSSFXSMWFRQPSXGDECGHFL 289 T T + PG PT+ + N S + R+ GD G+++ Sbjct: 987 TIITAEEVPGGPPTSIRVETNDQHSLVVYWKPPAREEWNGDILGYYV 1033 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,146 Number of Sequences: 336 Number of extensions: 2379 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -