BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G20 (625 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78413-7|CAB01657.1| 352|Caenorhabditis elegans Hypothetical pr... 93 1e-19 >Z78413-7|CAB01657.1| 352|Caenorhabditis elegans Hypothetical protein T01C3.7 protein. Length = 352 Score = 93.5 bits (222), Expect = 1e-19 Identities = 41/74 (55%), Positives = 53/74 (71%) Frame = +1 Query: 397 VIIEPHRHPGVFIXRGKXXALVTKNLVPXSXVYGEXXISLDNERDKVEYXVWNPFXSKLA 576 V++EPHR GVFI +GK AL TKN+V VYGE +S+D+ +EY VWNPF SKLA Sbjct: 117 VVVEPHRLGGVFIVKGKEDALATKNMVVGESVYGEKRVSVDDGAGSIEYRVWNPFRSKLA 176 Query: 577 AAIMGGVDAIHMAP 618 A+IMGG++ H+ P Sbjct: 177 ASIMGGLENTHIKP 190 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,046,824 Number of Sequences: 27780 Number of extensions: 92507 Number of successful extensions: 173 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -