BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G16 (581 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 9.5 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 9.5 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 22.6 bits (46), Expect = 9.5 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 163 VIVKRGSRCSVRQRHRETPGRGLPYPPHQDHSYFSQCALAR 285 +++KR + +R E PG +P PH SY S + + Sbjct: 345 LLMKRPRKTRLRWM-MEMPGMSVPPQPHTHPSYGSPAEIPK 384 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 455 RSLSCGFSSENDPRSLNLHHKEFYGW 378 R C E + R N++ +EFY W Sbjct: 377 RYAECSKRKEQN-RMFNINEREFYNW 401 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,071 Number of Sequences: 2352 Number of extensions: 13083 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -