BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G16 (581 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S ... 174 4e-44 At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S ... 174 4e-44 At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribo... 172 2e-43 At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ... 172 2e-43 At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast,... 56 2e-08 At1g20530.1 68414.m02558 hypothetical protein 29 1.7 At5g05740.2 68418.m00632 peptidase M50 family protein / sterol-r... 28 4.0 At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2... 28 5.2 At3g06960.2 68416.m00827 expressed protein 28 5.2 At3g06960.1 68416.m00826 expressed protein 28 5.2 At5g27220.1 68418.m03247 protein transport protein-related low s... 27 9.1 At3g18310.1 68416.m02330 expressed protein 27 9.1 >At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 174 bits (423), Expect = 4e-44 Identities = 77/109 (70%), Positives = 96/109 (88%) Frame = +2 Query: 218 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 397 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 398 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVXVEVTIADA 544 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGV VEVTIAD+ Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 174 bits (423), Expect = 4e-44 Identities = 77/109 (70%), Positives = 96/109 (88%) Frame = +2 Query: 218 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 397 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 398 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVXVEVTIADA 544 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGV VEVTIAD+ Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribosomal protein S20, Arabidopsis thaliana, PIR:T12992 Length = 124 Score = 172 bits (418), Expect = 2e-43 Identities = 76/103 (73%), Positives = 93/103 (90%) Frame = +2 Query: 236 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKT 415 IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PCGEG+ T Sbjct: 22 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNT 81 Query: 416 WDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVXVEVTIADA 544 WDRF++R+HKRVIDL S ++VKQITSI IEPGV VEVTIAD+ Sbjct: 82 WDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ribsomomal proteinS20, Arabidopsis thaliana, pir:T12992 Length = 124 Score = 172 bits (418), Expect = 2e-43 Identities = 76/103 (73%), Positives = 93/103 (90%) Frame = +2 Query: 236 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKT 415 IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PCGEG+ T Sbjct: 22 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNT 81 Query: 416 WDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVXVEVTIADA 544 WDRF++R+HKRVIDL S ++VKQITSI IEPGV VEVTIAD+ Sbjct: 82 WDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast, putative similar to 30S ribosomal protein S10 GB:P02364 [Escherichia coli] (est matches suggest the N-terminal extension) Length = 191 Score = 56.0 bits (129), Expect = 2e-08 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 1/120 (0%) Frame = +2 Query: 179 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 358 A+ V S I +++P +IRI L S V +E C +++ A+ + GPV +P Sbjct: 73 ASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLP 132 Query: 359 TKILRITTRKTPCGEGSKTWDRFQMRIHKRVID-LHSPSEIVKQITSINIEPGVXVEVTI 535 TK K+P + F++R H+R+ID L+ ++ + + +++ GV VEV + Sbjct: 133 TKKRIYCVLKSPHVHKDARF-HFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDVEVKL 191 >At1g20530.1 68414.m02558 hypothetical protein Length = 614 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -1 Query: 458 GRSLSCGFSSENDPRSLNLHHKEFYGW*YAGSWLACGLGPLHAASVSW 315 G +C S + P SLNL+H FY Y + P ++ +W Sbjct: 106 GEGTNCDLLSGSKPESLNLNHDSFYSRRYESGTITPPPPPPAPSNYAW 153 >At5g05740.2 68418.m00632 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains Pfam PF02163: Sterol-regulatory element binding protein (SREBP) site 2 protease Length = 527 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 233 GRPLPGVSRCLCLTLQRLPLFTITSLAEDVFGHD 132 G PLPGV+ RLP TI L VFG D Sbjct: 133 GSPLPGVNPLQLDDSMRLPKETIDILRGQVFGFD 166 >At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2) / HD-ZIP protein 2 identical to homeobox-leucine zipper protein HAT2 (HD-ZIP protein 2) [Arabidopsis thaliana] SP:P46601; contains Pfam profiles PF04618: HD-ZIP protein N terminus, PF02183: Homeobox associated leucine zipper, PF00046: Homeobox domain Length = 283 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 470 RESVGRSLSCGFSSENDPRSLNLH 399 +E +G SLS GFS ++P +NL+ Sbjct: 5 KEDLGLSLSLGFSQNHNPLQMNLN 28 >At3g06960.2 68416.m00827 expressed protein Length = 341 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 246 MRWIGETSAWGFSMSLPDT 190 MRW+GE W MS P T Sbjct: 4 MRWVGEGDIWDLDMSTPVT 22 >At3g06960.1 68416.m00826 expressed protein Length = 479 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 246 MRWIGETSAWGFSMSLPDT 190 MRW+GE W MS P T Sbjct: 4 MRWVGEGDIWDLDMSTPVT 22 >At5g27220.1 68418.m03247 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1181 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -2 Query: 286 LERAH--IARSKSDPDAVDRGDLCL 218 ++R H +A +K DPD+V RG +CL Sbjct: 691 IQRLHEKMAVTKLDPDSVRRGSICL 715 >At3g18310.1 68416.m02330 expressed protein Length = 873 Score = 27.1 bits (57), Expect = 9.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 310 WSQETEAACKGPSPHANQDPA 372 W+ +++ C GPSP +DP+ Sbjct: 400 WNAQSQMFCFGPSPSVGKDPS 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,536,830 Number of Sequences: 28952 Number of extensions: 272254 Number of successful extensions: 614 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -