BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G14 (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.9 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 6.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 6.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/37 (27%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +3 Query: 102 IMWKLLQESPTAYAIQFN----KENGYEIFITDFIYL 200 ++W L++ +PT Y I + +E F+++ YL Sbjct: 232 VVWPLVENNPTLYLIPVSVILISVGWWENFVSETSYL 268 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/37 (27%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +3 Query: 102 IMWKLLQESPTAYAIQFN----KENGYEIFITDFIYL 200 ++W L++ +PT Y I + +E F+++ YL Sbjct: 232 VVWPLVENNPTLYLIPVSVILISVGWWENFVSETSYL 268 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/32 (31%), Positives = 11/32 (34%) Frame = +3 Query: 495 WTSQTILRNTLNXKDKXLTAYKTKFGEIQHKH 590 WT N K K K K +Q KH Sbjct: 61 WTEINAFANVSPSKTKFFNLIKRKDSPVQKKH 92 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/32 (31%), Positives = 11/32 (34%) Frame = +3 Query: 495 WTSQTILRNTLNXKDKXLTAYKTKFGEIQHKH 590 WT N K K K K +Q KH Sbjct: 61 WTEINAFANVSPPKTKFFNLIKRKDSPVQKKH 92 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,553 Number of Sequences: 336 Number of extensions: 2869 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -