BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G12 (359 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 pro... 61 1e-09 U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. 61 1e-09 U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 pro... 61 1e-09 BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 p... 61 1e-09 BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 p... 61 1e-09 BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 p... 61 1e-09 BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 p... 61 1e-09 BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 p... 61 1e-09 AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA seq... 61 1e-09 BC051789-1|AAH51789.1| 525|Homo sapiens LOC129293 protein protein. 29 5.7 Z15115-1|CAA78821.1| 1031|Homo sapiens DNA topoisomerase II pro... 28 7.6 X68060-1|CAA48197.1| 1621|Homo sapiens DNA topoisomerase II prot... 28 7.6 U54831-1|AAB01982.1| 350|Homo sapiens topoisomerase IIb protein. 28 7.6 BC021863-1|AAH21863.1| 485|Homo sapiens Unknown (protein for IM... 28 7.6 AJ011721-1|CAA09753.1| 717|Homo sapiens topoisomerase II beta p... 28 7.6 AF087160-1|AAC77432.1| 1598|Homo sapiens DNA topoisomerase II be... 28 7.6 AB208879-1|BAD92116.1| 1009|Homo sapiens DNA topoisomerase II, b... 28 7.6 >Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 protein. Length = 161 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 35 VDPKFLRNMRFAKKHNKKGLKKM 57 >AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA sequence from clone RP11-632C17 on chromosome 6 Contains the gene for a novel protein similar to ribosomal protein L29 ). Length = 172 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 49 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGHGSKIFKESK 180 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G K + + Sbjct: 16 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMR 59 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 152 MDPKFLRNQRFCKKGNLKPAKQL 220 +DPKFLRN RF KK N K K++ Sbjct: 50 VDPKFLRNMRFAKKHNKKGLKKM 72 >BC051789-1|AAH51789.1| 525|Homo sapiens LOC129293 protein protein. Length = 525 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 41 ASKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPLAMDPKFLRNQ 178 A W+ +R + ++ LTE+ KS+G P + LA + + LR Q Sbjct: 226 AGNWERKRPVWVMLMVNSLTEVDIKSRGVPVLDLFLAQEAERLRKQ 271 >Z15115-1|CAA78821.1| 1031|Homo sapiens DNA topoisomerase II protein. Length = 1031 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 950 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 980 >X68060-1|CAA48197.1| 1621|Homo sapiens DNA topoisomerase II protein. Length = 1621 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 1540 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 1570 >U54831-1|AAB01982.1| 350|Homo sapiens topoisomerase IIb protein. Length = 350 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 269 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 299 >BC021863-1|AAH21863.1| 485|Homo sapiens Unknown (protein for IMAGE:4999541) protein. Length = 485 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 404 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 434 >AJ011721-1|CAA09753.1| 717|Homo sapiens topoisomerase II beta protein. Length = 717 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 636 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 666 >AF087160-1|AAC77432.1| 1598|Homo sapiens DNA topoisomerase II beta protein. Length = 1598 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 1517 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 1547 >AB208879-1|BAD92116.1| 1009|Homo sapiens DNA topoisomerase II, beta isozyme variant protein. Length = 1009 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 37 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKT 129 K+ K + S+N ++N RK + KKP+KT Sbjct: 928 KKRKASGSENEGDYNPGRKTSKTTSKKPKKT 958 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,866,172 Number of Sequences: 237096 Number of extensions: 762241 Number of successful extensions: 2129 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2129 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2190862868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -