BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G05 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 222 2e-60 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.4 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 222 bits (543), Expect = 2e-60 Identities = 100/126 (79%), Positives = 115/126 (91%) Frame = +1 Query: 91 MSWQDYVDKQLMASXCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGG 270 MS QDYVDKQL+AS CVTKAAIAGHDGN+WAKSEGFE+SK+E+ K+V GFE + +LTS G Sbjct: 1 MSCQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG 60 Query: 271 VTIAGTRYIYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLXEY 450 VT+AG RYIYLSGTD +IRAKLGKVGVHCMKT QAVV+SLYE+PIQPQQAASVVEKL +Y Sbjct: 61 VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY 120 Query: 451 LITCGY 468 L++CGY Sbjct: 121 LVSCGY 126 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 408 LDGFFIERNDHSLLCLH 358 + G IER DH++LC++ Sbjct: 327 ISGAPIERPDHAVLCVY 343 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,407 Number of Sequences: 438 Number of extensions: 3097 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -