BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F24 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 1.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.6 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 3.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.5 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 7.8 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 139 GNSLSESSPVYGTL*YSFRHFSAFFRLKLRMHNN 38 G+ SE +P G +H +FR LR+H+N Sbjct: 3 GSRSSEINPKEGLYDEGGKHTVHWFRKGLRLHDN 36 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +2 Query: 320 PADTQTALVESQWNQVKNAIDAFIQESNANIASYQKEINATXALLPYDQMTMEDFYDAHP 499 PA+ + + + +D F++E A++A + + T ++ P + + A+P Sbjct: 54 PAEEGEGMAGVTGEEPFDTLDTFLRELQADLAEASQPTSTTTSVTPSCRRQRYNIAAANP 113 Query: 500 DLA 508 LA Sbjct: 114 LLA 116 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 172 FESSKVRFLFGGNSLSESSPVYGTL 98 ++S +V F + ++ ++ PVYGTL Sbjct: 75 YKSPQVDFGYDISNFTDVDPVYGTL 99 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +2 Query: 146 QKAHLAAFKIKSDNYLRRVLANPPEPPKINWAVYKQAVPIPG 271 Q H AA++ + N + RVL+ + + YK V + G Sbjct: 99 QDVHSAAYRCVASNSVGRVLSRDVQVRAVVAQAYKVDVEVIG 140 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +2 Query: 146 QKAHLAAFKIKSDNYLRRVLANPPEPPKINWAVYKQAVPIPG 271 Q H AA++ + N + RVL+ + + YK V + G Sbjct: 99 QDVHSAAYRCVASNSVGRVLSRDVQVRAVVAQAYKVDVEVIG 140 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.8 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 35 GIIVHS*L*SKKRRKMAKRISQSAVNWAALAERVPAEQKAHLAAFKI 175 G++++S + R + R+ + WA A + A A+LAAF + Sbjct: 619 GVLLNSGIGEGTPRSFSARVL--GMVWAGFAMIIVASYTANLAAFLV 663 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +2 Query: 320 PADTQTALVESQWNQVKNAIDAFIQESNANIASYQKEI 433 P T LVE N+++NA+ + +++ +E+ Sbjct: 351 PGLRNTELVERMHNKLRNALQTVLAQNHPQHPDILREL 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,809 Number of Sequences: 438 Number of extensions: 3794 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -