BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F22 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 25 0.72 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.1 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 6.7 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 21 8.9 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 24.6 bits (51), Expect = 0.72 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 2/111 (1%) Frame = +1 Query: 181 RGIKAKIFNKERRNEKIQMKKKIKAHEEKNVKQNTEKVAEGALPVYLLDRDVQSRAKVLS 360 RG K + KE + E ++ + KIK + VK++++ + P+ L+ + R K LS Sbjct: 175 RGTKIVLHMKEDQTEFLE-EHKIK----EIVKKHSQFIG---YPIKLVVE--KEREKELS 224 Query: 361 N-MIKQKRKEKAGK-WDVPIPKVRAQADAEVFKVLKSGKSKRKAWKRMVTK 507 + ++++KE+ G+ D PK+ + E K K K+K K T+ Sbjct: 225 DDEAEEEKKEEEGEDKDKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTE 275 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = +1 Query: 460 KSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKKAHV 600 KS K K W+R++ FV PK + ++ + + + H+ Sbjct: 580 KSAKPMLKPWQRVLPDGVFVAFLLKHIVPKLQLCMQNLVINPHQQHL 626 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -1 Query: 207 IEYFSFDTAEFARLFSAFMRLTSFTLPFS 121 I F D EFA L + + TSF P S Sbjct: 287 ISQFQLDAHEFACLRAIVLFKTSFEKPSS 315 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 71 YSFCGMLVAYSATYAVTI 18 ++FC M++A TY V + Sbjct: 352 WTFCHMMIAALTTYLVIL 369 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,309 Number of Sequences: 336 Number of extensions: 2442 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -