BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F16 (505 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces... 99 3e-22 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 28 0.92 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 27 1.2 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 27 2.1 SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 3.7 SPBC32C12.02 |ste11|aff1, stex|transcription factor Ste11|Schizo... 25 8.5 >SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces pombe|chr 3|||Manual Length = 118 Score = 99.1 bits (236), Expect = 3e-22 Identities = 46/62 (74%), Positives = 55/62 (88%) Frame = +3 Query: 141 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRK 320 +K Q S +HRIRITLTSRNVR+LEKVC+DL+N AK ++LRVKGPVR+PTKIL+ITTRK Sbjct: 8 QKEQQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRK 67 Query: 321 TP 326 TP Sbjct: 68 TP 69 Score = 88.6 bits (210), Expect = 5e-19 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = +1 Query: 331 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVXVEVTIA 471 GEGSKTW+ ++MRIHKR+IDLHSPSEIVKQITSI+IEPGV VEVTIA Sbjct: 71 GEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVTIA 117 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 27.9 bits (59), Expect = 0.92 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 123 VSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVK 272 +S IEKP+A SPIH + +R L+ V GA++ + VK Sbjct: 891 LSSSLIEKPRASSSPIHH----ANNNGLRLLKDVLKKTYRGARENRSSVK 936 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 27.5 bits (58), Expect = 1.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 114 AAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRS 212 A V + D+EKPQ +V+ R+ L S N R+ Sbjct: 491 ANVTTSADVEKPQVKVATSSRVDYDLKSPNQRT 523 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 26.6 bits (56), Expect = 2.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 134 RHRETPGRGLPYSP 175 R ETPGR LP+SP Sbjct: 163 RANETPGRNLPFSP 176 >SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 841 Score = 25.8 bits (54), Expect = 3.7 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 364 MRIHKRVIDLHSPSEIVKQITSINIEPGV 450 +R+H+R I L + S+ ++ + NIE G+ Sbjct: 406 LRVHERAIKLRTLSDSIRADVAENIEMGI 434 >SPBC32C12.02 |ste11|aff1, stex|transcription factor Ste11|Schizosaccharomyces pombe|chr 2|||Manual Length = 468 Score = 24.6 bits (51), Expect = 8.5 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 26 KREVSPASALNNF*LKSCLSRPEFNKQHGSRCSVRQRHRE-TPGRG 160 K+ S SAL K L PE+ R +VR+RH++ +P G Sbjct: 58 KKYYSDLSALER--QKHMLENPEYKYTPKKRSTVRRRHKKVSPSSG 101 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,053,954 Number of Sequences: 5004 Number of extensions: 41724 Number of successful extensions: 108 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 200198394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -