BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F16 (505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 1.5 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.0 bits (52), Expect = 1.5 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 4/75 (5%) Frame = -3 Query: 437 MLIEVICFTISEGECRSITLLW-IRI*KRSQVFEPSPTRSFT---GGDTQDLGWHADWAL 270 ML+ ++ F I +I +L+ + + + F PS SF+ G T + W + W++ Sbjct: 149 MLVNLVVFVILLLAAITIYVLFNVSLAELEPNFTPSHPVSFSEGIGNRTLYMSWPSSWSV 208 Query: 269 YTQLLFLGSID*VST 225 ++ G+I ST Sbjct: 209 FSSASQRGAISFAST 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,534 Number of Sequences: 2352 Number of extensions: 11287 Number of successful extensions: 14 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -