BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F04 (405 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752904-1|AAV30078.1| 84|Anopheles gambiae peroxidase 10 prot... 25 1.0 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 23 5.6 >AY752904-1|AAV30078.1| 84|Anopheles gambiae peroxidase 10 protein. Length = 84 Score = 25.0 bits (52), Expect = 1.0 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 205 EIGSRQLVCIPHITEADLYKVTSLFVPNEKEINGKNFTPL 324 E+GS+ PH + DLY L P + + G+ F L Sbjct: 2 EVGSKLRALYPHPDDVDLYVGGILEPPVDGGVVGETFAEL 41 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 22.6 bits (46), Expect = 5.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 347 FNFLTILPRGVKFLPL 300 FNF +PR +KF P+ Sbjct: 459 FNFSATIPRKIKFEPV 474 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 332,938 Number of Sequences: 2352 Number of extensions: 5539 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -