BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E22 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 35 6e-04 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 35 8e-04 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 30 0.017 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 27 0.21 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.36 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.36 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 1.1 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 1.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.4 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.5 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.9 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.9 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 5.9 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.8 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 35.1 bits (77), Expect = 6e-04 Identities = 34/118 (28%), Positives = 55/118 (46%) Frame = +3 Query: 114 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKS 293 M K++ N+ VI HVD GKST T L+ K G I R E +F + E + + K Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KF-EKEAQEMGKG-SFKY 56 Query: 294 TAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + E + + I + ++ K + + +ID+PGH DF + D A+ Sbjct: 57 AWVLDKLKAERERGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 34.7 bits (76), Expect = 8e-04 Identities = 34/118 (28%), Positives = 55/118 (46%) Frame = +3 Query: 114 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKS 293 M K++ N+ VI HVD GKST T L+ K G I R E +F + E + + K Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KF-EKEAQEMGKG-SFKY 56 Query: 294 TAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + E + + I + ++ K + + +ID+PGH DF + D A+ Sbjct: 57 AWVLDKLKAERERGITIDIALWKFETAK-YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +3 Query: 372 EKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPI 551 E G + +D+PGH F S +TD + QT + A ++ I Sbjct: 190 ESGERVTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKEQTLQSIEMAKDAKVPII 249 Query: 552 LFMNKMDR 575 + +NK+D+ Sbjct: 250 VAINKIDK 257 Score = 29.5 bits (63), Expect = 0.030 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 141 MSVIAHVDHGKSTLTDSL 194 ++++ HVDHGK+TL D+L Sbjct: 148 VTIMGHVDHGKTTLLDAL 165 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 26.6 bits (56), Expect = 0.21 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 84 ISRLDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSL 194 +S+L + + ++ N+ I HV HGKST+ ++ Sbjct: 26 VSKLTALSREVISRQATINIGTIGHVAHGKSTIVKAI 62 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.8 bits (54), Expect = 0.36 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 478 TVCLVCVYKPKQYCVRLLP 534 TV LVC+Y PK Y + P Sbjct: 749 TVTLVCLYSPKIYIILFQP 767 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 25.8 bits (54), Expect = 0.36 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 478 TVCLVCVYKPKQYCVRLLP 534 TV LVC+Y PK Y + P Sbjct: 839 TVTLVCLYSPKIYIILFQP 857 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 381 FLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + +ID+PGH DF + D A+ Sbjct: 12 YYVTIIDAPGHRDFIKNMITGTSQADCAV 40 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 381 FLINLIDSPGHVDFSSEVTAALRVTDGAL 467 + + +ID+PGH DF + D A+ Sbjct: 28 YYVTIIDAPGHRDFIKNMITGTSQADCAV 56 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/21 (38%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +3 Query: 3 PFSKRTPLLAYGSW-FNRTKI 62 PF ++T ++ +GSW FN ++ Sbjct: 159 PFDQQTCIMKFGSWTFNGDQV 179 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 3 PFSKRTPLLAYGSW 44 PF ++T +L +GSW Sbjct: 161 PFDEQTCVLKFGSW 174 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 300 ISMFFELEEKDLVFITNPDQREKSEKGFLI 389 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 77 MVNFTARRDPWDDGQEAEYP 136 +VN+ +R D D E +YP Sbjct: 324 LVNYASRSDMHSDNIEKKYP 343 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 77 MVNFTARRDPWDDGQEAEYP 136 +VN+ +R D D E +YP Sbjct: 324 LVNYASRSDMHSDNIEKKYP 343 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 3 PFSKRTPLLAYGSWFNRTKIINHLKW*ISRLDEIRG 110 PF ++T ++ +GSW + + + +DEIRG Sbjct: 157 PFDEQTCVMKFGSW-----TYDGFQVDLRHIDEIRG 187 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 5.9 Identities = 18/72 (25%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Frame = -1 Query: 599 KXEXLKKSTVHFVHEQNRLDALGNSL--TQYCFGLYTHTRHTVNNHKGSISDTECSCYFR 426 K E K+ + N L + S T C Y +RH N + + CS Sbjct: 199 KSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 Query: 425 REINVSR*VNQV 390 RE R +Q+ Sbjct: 259 REYKKDRRYDQL 270 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 484 TQSTTTRAP-SVTRSAAVTSEEKSTC 410 + STTT +P + T+S V + STC Sbjct: 324 SSSTTTTSPMTSTKSTIVRNHLNSTC 349 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 300 ISMFFELEEKDLVFITNPDQREKSEKGFLI 389 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 276 CITIKSTAISMFF 314 C T+K +A+ M+F Sbjct: 688 CATVKGSAVDMYF 700 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 478 TVCLVCVYKPKQYCVRLLP 534 +V + C++ PK Y + + P Sbjct: 891 SVTIACLFSPKLYIILIRP 909 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,011 Number of Sequences: 438 Number of extensions: 3742 Number of successful extensions: 25 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -