BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E21 (639 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 1.2 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 5.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 5.0 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 5.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 5.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.6 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.8 bits (49), Expect = 1.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 Query: 475 CRLSTHHYWCSCLWSYEG 528 C+ T HY C C + Y G Sbjct: 76 CQDHTTHYTCHCPYGYTG 93 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 514 WSYEGCC*RWPQCSSFHQKIPXL*CXIQ 597 WS W CSSF Q+ C I+ Sbjct: 403 WSVNAGMWMWLSCSSFFQQFFHCYCPIK 430 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.8 bits (44), Expect = 5.0 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 237 GLKVTILCALLIHMSCHVMV*RLV*QIMLQHIQLVCY*HEDC 362 G K IL +L ++C VMV + + IQ+V Y + +C Sbjct: 182 GNKPVILTVVLPLLACGVMVVTHITMAHFKIIQVVPYCYINC 223 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 73 RGTK*NSTRRREGKTDYYARKRLACS 150 RG + NST RR+ + YY R+ S Sbjct: 114 RGPR-NSTLRRQQMSSYYNESRVMMS 138 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 73 RGTK*NSTRRREGKTDYYARKRLACS 150 RG + NST RR+ + YY R+ S Sbjct: 114 RGPR-NSTLRRQQMSSYYNESRVMMS 138 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 365 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNK 267 E + +L ++ LNM Q + SH ++ VN+ Sbjct: 301 EQMNLLHSNDLNMHQQHHQQNMSHEELSAMVNR 333 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 549 LRPPSTAPFIAPKT 508 L PP++ P ++PK+ Sbjct: 106 LTPPNSEPLVSPKS 119 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 365 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 258 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 365 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 258 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 365 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 258 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 365 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 258 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,491 Number of Sequences: 336 Number of extensions: 3216 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -